SecReT4
Protein ID: 317054629
T4SS name [ID]Tra_I [164]
Gene symboltraS
Locus tagp3521_p040
StrainEscherichia coli plasmid p3521 (NC_014843)
Repliconplasmid p3521 [GenBank: NC_014843] [Browse all T4SS(s) in this replicon]
Location [Strand]38329..38580 [+]
ProductTraS
Component typeTraS_I
UniProt IDQ68JA4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 83 a.a.     [Download]
>gi|317054629|ref|YP_004119696.1| TraS [Escherichia coli]
MSCELPPFTLLRTEHGNVIARDNRDNQEFVFAECYSTAIAALILAAVTLYTERKAYEKDPATHRPGPGTM
AFPAPATGHGIQR
 
Nucleotide Sequence: 252 bp     [Download]
>gi|317054589|ref|NC_014843.1|:38329-38580 Escherichia coli plasmid p3521, complete sequence
ATGTCCTGTGAGCTGCCCCCTTTCACCCTGCTCAGAACAGAGCACGGCAACGTGATTGCCCGCGACAACC
GGGATAATCAGGAGTTTGTGTTTGCAGAGTGTTACTCCACCGCTATAGCAGCACTGATTCTGGCTGCCGT
CACCCTGTATACAGAGAGAAAAGCGTATGAAAAAGACCCCGCCACTCATCGCCCCGGTCCGGGAACGATG
GCTTTTCCCGCTCCCGCAACCGGACACGGTATTCAGCGGTGA