SecReT4
Protein ID: 317054630
T4SS name [ID]Tra_I [164]
Gene symboltraT
Locus tagp3521_p041
StrainEscherichia coli plasmid p3521 (NC_014843)
Repliconplasmid p3521 [GenBank: NC_014843] [Browse all T4SS(s) in this replicon]
Location [Strand]38687..39313 [+]
ProductTraT
Component typeTraT_I
UniProt IDQ68JA3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 208 a.a.     [Download]
>gi|317054630|ref|YP_004119697.1| TraT [Escherichia coli]
MADTCRDTVVLLEKNLTRVMRLKKRPVPENADEKKKHTRTLQDAERSLAQARLSARRLALRHVEKSQIVT
TDALSENESDLLQPEGPPFHLCAFCHAWHCLNGYAAAQGVMVWLPDLHPASVVALNARALQEIFSDNRQR
VRQGRAVLNALVQNRLAVEEKFRTWRPADFADALRRWPPAQRKTLREKMDGVALILLPDSFPDKKYVM
 
Nucleotide Sequence: 627 bp     [Download]
>gi|317054589|ref|NC_014843.1|:38687-39313 Escherichia coli plasmid p3521, complete sequence
ATGGCTGACACCTGCCGGGATACGGTCGTCCTGCTGGAAAAAAACCTCACCCGGGTGATGCGCCTGAAAA
AACGTCCGGTACCGGAAAACGCTGACGAAAAAAAGAAACACACCCGAACCCTGCAGGATGCGGAGCGGTC
CCTGGCACAGGCCCGCCTGTCGGCCAGGCGACTGGCCCTGCGTCATGTGGAAAAGTCGCAAATCGTCACA
ACGGATGCACTCAGCGAAAATGAAAGTGACCTGCTGCAGCCGGAAGGCCCGCCCTTTCATCTCTGTGCCT
TCTGCCATGCCTGGCACTGTCTGAACGGCTATGCTGCCGCACAGGGAGTGATGGTCTGGCTCCCCGATTT
GCATCCGGCCTCGGTGGTTGCCCTCAATGCGCGGGCACTGCAGGAGATTTTCAGCGATAACCGTCAGCGG
GTCAGGCAGGGACGGGCAGTCCTGAATGCCCTGGTACAGAACCGTCTGGCCGTTGAGGAGAAATTCCGCA
CCTGGCGTCCGGCGGATTTTGCAGATGCCCTGCGCCGCTGGCCGCCGGCACAGCGTAAAACGTTGAGGGA
GAAAATGGACGGGGTGGCGCTCATTCTGCTGCCGGATTCGTTTCCTGACAAAAAGTACGTCATGTGA