SecReT4
Protein ID: 317054632
T4SS name [ID]Tra_I [164]
Gene symboltraV
Locus tagp3521_p043
StrainEscherichia coli plasmid p3521 (NC_014843)
Repliconplasmid p3521 [GenBank: NC_014843] [Browse all T4SS(s) in this replicon]
Location [Strand]42652..43272 [+]
ProductTraV
Component typeTraV_I
UniProt IDQ68JA1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 206 a.a.     [Download]
>gi|317054632|ref|YP_004119699.1| TraV [Escherichia coli]
MYSIHIPPRCRRPARGQVFLKTLRVDGDSFSFTLPSACFTLRPSPNPRVIFASDRRADGEMSGIRLALPG
ETGTLITTATWQVNVPERPPFDIQHVIHWLLPAPLTALMSDNTWLWPDVPGTPALTAGDWPVMESDTPTL
KRVKRRTFTLIDNRNRQGWITRRFQCFPLAPLPESLSHRVPDILYPPKTEKKECKDNLQPHCLHSL
 
Nucleotide Sequence: 621 bp     [Download]
>gi|317054589|ref|NC_014843.1|:42652-43272 Escherichia coli plasmid p3521, complete sequence
ATGTACAGCATTCATATCCCCCCCCGCTGCCGGCGTCCTGCCCGGGGACAGGTCTTCCTGAAAACGCTGC
GCGTGGACGGTGACAGTTTCAGCTTCACCCTGCCGTCCGCCTGCTTCACACTGCGACCGTCCCCCAATCC
CCGGGTCATTTTTGCCAGTGACAGACGGGCTGACGGGGAGATGAGTGGTATTCGCCTGGCCCTGCCCGGA
GAGACAGGCACGCTGATAACAACGGCCACCTGGCAGGTTAACGTGCCGGAGCGACCGCCTTTTGATATAC
AGCATGTCATTCACTGGCTTCTGCCCGCACCACTCACTGCGCTGATGTCTGACAACACCTGGCTGTGGCC
GGATGTCCCCGGCACACCGGCACTCACAGCCGGAGACTGGCCGGTCATGGAAAGCGACACCCCGACACTG
AAACGCGTGAAGCGTCGTACCTTCACGCTCATCGATAACCGTAACCGTCAGGGATGGATCACGCGCCGCT
TCCAGTGTTTCCCGCTGGCTCCGCTGCCGGAATCACTCAGTCATCGCGTACCAGACATCCTGTATCCCCC
GAAAACGGAGAAAAAAGAATGCAAAGACAATCTGCAACCACACTGCTTGCACTCCTTGTAG