SecReT4
Protein ID: 317054633
T4SS name [ID]Tra_I [164]
Gene symboltraW
Locus tagp3521_p044
StrainEscherichia coli plasmid p3521 (NC_014843)
Repliconplasmid p3521 [GenBank: NC_014843] [Browse all T4SS(s) in this replicon]
Location [Strand]43395..44435 [+]
ProductTraW
Component typeTraW_I
UniProt IDQ68JA0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 346 a.a.     [Download]
>gi|317054633|ref|YP_004119700.1| TraW [Escherichia coli]
MQTATGTAITQNSEKLATVIAQDGQATRQQMIFSNETHRLEEARKSFSVPDSICSESASGIAAESRRAAA
SAAARLSQGGGVSSKPIRERLSRAADSPVREAYDSAGIHAGYCTEAEYARFGGTDVCPAVGDLPGGDSQV
RSLYQGAGTADTPAALTWDQKQIDAATAYMKNTARPSAGRAPGKGEVGTQTGRTYVGLQNEYNGIIDAAS
HPQLSLIADSTPNEATRGALTEALQSPSAAAYFDRTASSEARTRGHMSQREFEAFEAGRRYANTDWQQDL
QGMEGDNLLRELLRTTALLNWQMNDLKEQIRQGNVIAGQQLALAARQYYGQRLGELSQAMSQGSVR
 
Nucleotide Sequence: 1041 bp     [Download]
>gi|317054589|ref|NC_014843.1|:43395-44435 Escherichia coli plasmid p3521, complete sequence
ATGCAGACGGCCACCGGCACAGCCATCACCCAGAACTCAGAAAAACTGGCCACCGTCATTGCCCAGGACG
GGCAGGCCACCCGTCAGCAGATGATATTCAGTAATGAAACACACCGCCTCGAGGAGGCCAGGAAAAGCTT
CAGCGTGCCGGACTCCATCTGCAGTGAATCCGCGTCCGGCATTGCAGCAGAAAGCCGCCGGGCAGCAGCG
TCTGCAGCGGCACGTCTGAGTCAGGGGGGAGGGGTCAGCAGTAAACCCATCCGGGAACGTCTCTCCCGGG
CTGCGGACTCCCCGGTCCGCGAGGCGTATGATAGTGCCGGCATCCACGCCGGTTACTGCACGGAAGCGGA
GTATGCCCGCTTTGGCGGAACTGATGTCTGCCCTGCCGTGGGCGATCTGCCGGGCGGAGACAGCCAGGTA
CGATCGCTCTATCAGGGCGCAGGCACAGCAGATACCCCGGCCGCTCTCACCTGGGATCAGAAACAGATTG
ATGCCGCGACGGCTTATATGAAAAACACCGCCAGACCGTCAGCGGGTCGTGCCCCGGGGAAAGGAGAAGT
GGGCACACAGACCGGGCGCACGTATGTGGGCCTGCAGAATGAATACAACGGCATCATCGATGCCGCCTCT
CATCCGCAGCTGTCACTGATTGCTGACAGTACCCCTAATGAAGCCACCCGTGGGGCACTGACTGAAGCCC
TGCAGTCACCGTCAGCTGCGGCATATTTTGACCGGACCGCATCATCAGAAGCCCGCACCCGTGGCCACAT
GAGCCAGCGGGAGTTTGAGGCCTTTGAAGCCGGCAGACGGTATGCCAACACCGACTGGCAGCAGGATCTG
CAGGGCATGGAAGGCGATAACCTTCTCCGTGAGCTGCTGCGCACCACCGCCCTGCTGAACTGGCAGATGA
ACGATCTGAAAGAGCAGATTCGTCAGGGTAACGTTATCGCCGGGCAGCAACTTGCGCTGGCCGCACGGCA
GTATTACGGACAGCGCCTTGGCGAACTGTCACAGGCCATGAGCCAGGGGAGCGTAAGATGA