SecReT4
Protein ID: 317054634
T4SS name [ID]Tra_I [164]
Gene symboltraX
Locus tagp3521_p045
StrainEscherichia coli plasmid p3521 (NC_014843)
Repliconplasmid p3521 [GenBank: NC_014843] [Browse all T4SS(s) in this replicon]
Location [Strand]44432..45001 [+]
ProductTraX
Component typeTraX_I
UniProt IDQ68J99
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 189 a.a.     [Download]
>gi|317054634|ref|YP_004119701.1| TraX [Escherichia coli]
MKDDNSIDEKKPAPRLRRIGDIGINLFAPLAETRWMLRSCRHMLDQHKTRLKRLMPDRQPESPVCMTWEE
AVRASGLTVDELDRRLRRRRMFWRTGFWLMMIPVLLLCGMALAATALPVITLIRILVCLLLMSTIAALCA
SKALIASYRLWQLNERRVSEDEQGTFPDYLQARHGWKQATWLAITHRQY
 
Nucleotide Sequence: 570 bp     [Download]
>gi|317054589|ref|NC_014843.1|:44432-45001 Escherichia coli plasmid p3521, complete sequence
ATGAAAGACGACAACAGCATCGACGAAAAAAAACCGGCCCCCCGTCTCCGCCGCATCGGTGATATAGGGA
TAAATCTGTTCGCACCACTGGCCGAAACCCGCTGGATGCTGCGCAGCTGCCGCCATATGCTGGACCAGCA
TAAAACGCGCCTGAAGCGCCTCATGCCCGACCGGCAACCGGAGAGTCCGGTCTGTATGACCTGGGAGGAA
GCGGTCAGGGCCAGCGGACTGACGGTCGACGAACTGGACCGGCGTCTGCGACGTCGCAGGATGTTCTGGC
GGACAGGATTCTGGCTGATGATGATACCGGTACTTCTGCTGTGTGGTATGGCCCTTGCGGCCACCGCACT
GCCGGTCATCACCCTGATACGTATCCTGGTCTGCCTGTTACTGATGAGTACCATTGCAGCACTGTGTGCC
TCAAAAGCCCTGATTGCGTCATACCGCCTCTGGCAGTTGAATGAACGTCGGGTCAGCGAGGACGAACAGG
GCACATTCCCCGATTACCTGCAGGCCCGGCACGGCTGGAAACAGGCCACATGGCTGGCCATTACCCACCG
GCAGTACTGA