SecReT4
Protein ID: 317054635
T4SS name [ID]Tra_I [164]
Gene symboltraY
Locus tagp3521_p046
StrainEscherichia coli plasmid p3521 (NC_014843)
Repliconplasmid p3521 [GenBank: NC_014843] [Browse all T4SS(s) in this replicon]
Location [Strand]45076..47247 [+]
ProductTraY
Component typeTraY_I
UniProt IDE7BTA3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 723 a.a.     [Download]
>gi|317054635|ref|YP_004119702.1| TraY [Escherichia coli]
MKIIPRALSAGLALAAVPAQAFVTYQDIVSAATNPDDLSRQALVTIFGDVVTNPLTASSNTIIGNLFMVF
NAIIATMGIVWFLFIGIRHAVRTGNQGNVFNNGRDVVGILSVFFGFFMIVPTASGWSLAQLVMLWGASIM
GIGSANIMVQTAAENIAEGYSMTVQPVHVSTRTAARGILEMELCKHAMNTGLNDFNRTARSSTPPMSESS
RTENGRYTVTVSNGSATCGSVSLSVKGNGSNKQSALAHFFNPFIETEYQGVLTAQRSAMDTMLRDLDSAA
QEFVSAYRTRRDTGNGNLPDIESRIQKAANRYEETVQKALPADNAETERREQLKSYLTTYGWVALGAWYQ
TFATANQRLEDLANRAPTVSGVSSLGEAGDTEFLKEVKGAYQAQLQNSPYTPALGTNTSSTEYRTAEAAE
PKSAILMKVWSGFKFCRQICWTSTYLSGTGTSSDQLNPLIKMKNIGDYTMGITESIWAGYTTVRVLSTAG
SNSVFGRLVNAVSGLSDAAKAFLEASAPPLYFLLFLLFCAGFSLSIYLPFIPFIFWMTGIGNWIVSVLIG
CAAGPLWAATHLGTSQDRGSRAAYGYIYLIDSMIRPLLMVFGFFFASVAIVAGGTILNALFGAALVNVQA
DSLTGLFSIAGFLLIYARVCTTLVAAVFALQAYLPDHVINFLGGRDGVNMLGNMVSSVKDIIAGGNTNMR
RTPGVREEKLKSINGDVLDGIQQ
 
Nucleotide Sequence: 2172 bp     [Download]
>gi|317054589|ref|NC_014843.1|:45076-47247 Escherichia coli plasmid p3521, complete sequence
GTGAAAATCATACCCAGAGCACTGAGTGCAGGTCTGGCGCTGGCTGCCGTACCTGCACAGGCTTTCGTCA
CCTATCAGGACATTGTGAGTGCCGCCACCAATCCGGATGACCTGTCGCGCCAGGCACTGGTCACCATTTT
TGGTGATGTGGTCACAAATCCCCTGACAGCCAGCAGCAACACCATCATTGGCAACCTGTTCATGGTGTTT
AACGCAATTATCGCCACGATGGGGATAGTCTGGTTTCTGTTTATTGGTATCCGTCATGCTGTCCGCACGG
GAAACCAGGGCAATGTTTTTAACAACGGACGGGACGTCGTCGGCATACTCAGTGTCTTTTTTGGATTTTT
CATGATTGTGCCCACCGCTTCCGGTTGGAGTCTGGCGCAACTGGTCATGCTGTGGGGCGCATCCATCATG
GGCATCGGTTCCGCCAATATCATGGTTCAGACAGCGGCAGAAAACATTGCTGAAGGCTATTCAATGACCG
TACAGCCAGTTCATGTCTCCACCCGCACGGCAGCACGGGGAATTCTGGAGATGGAACTGTGCAAACACGC
CATGAATACGGGCCTCAATGACTTTAACCGTACCGCACGTTCATCCACGCCGCCCATGAGCGAATCCTCA
CGGACAGAGAATGGCAGATATACCGTCACCGTCTCAAATGGCAGCGCCACCTGCGGGAGTGTGAGTCTCT
CCGTGAAAGGAAACGGCAGTAACAAGCAGTCCGCGCTGGCCCATTTTTTCAATCCCTTCATTGAAACGGA
ATATCAGGGGGTTCTGACGGCACAGCGCTCCGCCATGGATACCATGCTCCGTGACCTGGACAGCGCGGCG
CAGGAATTTGTGTCGGCATACCGGACCCGGCGCGACACGGGTAACGGCAACCTGCCGGATATTGAAAGCC
GTATTCAGAAGGCAGCCAACCGGTATGAAGAAACGGTGCAGAAGGCGTTGCCGGCAGATAACGCAGAAAC
TGAGCGCAGGGAGCAGCTGAAATCCTACCTGACCACCTACGGCTGGGTTGCCCTGGGTGCCTGGTACCAG
ACCTTTGCCACCGCCAACCAGCGACTGGAAGACCTGGCCAACCGCGCCCCTACCGTGAGTGGCGTCTCGT
CACTGGGCGAAGCCGGGGATACGGAATTCCTGAAGGAAGTCAAGGGGGCTTACCAGGCACAGTTGCAGAA
TTCACCATATACTCCTGCACTGGGAACAAACACTTCATCAACTGAATACAGAACAGCGGAAGCCGCTGAA
CCTAAATCAGCAATCTTAATGAAAGTATGGTCCGGGTTTAAATTTTGCAGACAAATTTGCTGGACATCCA
CTTATCTGAGCGGAACAGGAACATCCTCGGACCAACTAAATCCACTGATAAAAATGAAAAATATCGGTGA
TTACACTATGGGTATTACTGAAAGCATATGGGCGGGTTATACCACCGTCAGGGTACTTTCCACAGCCGGC
AGCAACTCCGTTTTTGGTCGACTGGTCAATGCCGTCAGCGGATTATCTGACGCCGCAAAGGCTTTTCTGG
AAGCATCCGCACCACCACTCTACTTCCTGCTGTTTTTGCTGTTCTGTGCCGGCTTTTCGTTATCCATTTA
CCTGCCGTTTATCCCGTTTATCTTCTGGATGACCGGCATCGGCAACTGGATAGTCAGCGTACTGATTGGA
TGTGCTGCTGGCCCCCTGTGGGCCGCCACCCATCTGGGAACAAGCCAGGACAGGGGAAGCCGGGCTGCTT
ACGGTTACATCTACCTGATAGACAGCATGATCAGACCGCTGCTGATGGTGTTCGGATTCTTTTTTGCATC
GGTCGCCATCGTGGCCGGCGGCACCATTCTGAATGCGTTGTTTGGCGCGGCTCTGGTTAATGTGCAGGCG
GACTCCCTTACGGGGTTATTCAGCATCGCTGGATTTTTGCTGATTTATGCCCGAGTCTGTACCACACTGG
TTGCAGCCGTTTTTGCGCTTCAGGCTTATCTGCCTGACCATGTAATTAATTTTCTGGGCGGACGTGACGG
TGTTAATATGCTGGGGAATATGGTTTCTTCAGTCAAAGATATTATTGCCGGAGGTAATACCAATATGCGC
AGAACACCTGGCGTTCGTGAAGAAAAACTGAAAAGTATTAATGGAGATGTTTTAGACGGAATACAACAAT
AA