SecReT4
Protein ID: 317054648
T4SS name [ID]Tra_I [164]
Gene symboltrbA
Locus tagp3521_p059
StrainEscherichia coli plasmid p3521 (NC_014843)
Repliconplasmid p3521 [GenBank: NC_014843] [Browse all T4SS(s) in this replicon]
Location [Strand]54734..56050 [+]
ProductTrbA
Component typeTrbA_I
UniProt IDE7BTB6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 438 a.a.     [Download]
>gi|317054648|ref|YP_004119715.1| TrbA [Escherichia coli]
MSYQHSPTTEDPMNIWYIVGTICLLFALLIWLFLPDIVFATCLILHTMWGMTDWGPFHHFAAPRYNLLAI
TANNAATITFGQWLDVMSRTVGILWLILLPMTFGFLWMWFHHPAQPRFTRRPLNIHTLPHIFSALSPAIA
PVLADGDNNRLFHGQKRPERRVALTPEVFVEQNNLIRNMQLDVASTRQCFMAQLGQPLTSWKDMAPHEKA
LFAIFGLQFFLGDRKAAVALMNNLNLSCRLKSKRDQGRFSTPVYSLARNAFIRVIKTEGAQQWLRQHRYV
RSGLVWLYAHDLRLTPPNWLWLKGVDRTLFYALHRANTTKGFIERAGVVAVARAKNEASRLGLPCPEPCV
EEAIEGFRRDMLGLGLIWDEPQPDRDCKRQIRTRWSLTDDVIPRRHDNDEDTDTGETTETTETTETTETT
ETTETTEKQHPADKEKEQ
 
Nucleotide Sequence: 1317 bp     [Download]
>gi|317054589|ref|NC_014843.1|:54734-56050 Escherichia coli plasmid p3521, complete sequence
GTGTCTTACCAACACTCCCCCACAACAGAAGACCCGATGAACATATGGTATATCGTTGGCACCATATGTC
TGCTCTTTGCGCTTCTCATCTGGCTCTTTTTACCCGACATCGTCTTTGCCACCTGCCTGATCCTGCACAC
AATGTGGGGGATGACTGACTGGGGGCCTTTTCACCATTTTGCCGCCCCCCGTTACAACCTGCTGGCCATC
ACTGCTAACAACGCGGCAACCATCACTTTCGGCCAGTGGCTGGATGTTATGTCCCGGACAGTGGGGATCC
TCTGGTTGATTCTGCTTCCCATGACATTCGGCTTTCTGTGGATGTGGTTTCACCATCCGGCCCAGCCCCG
TTTTACCCGCAGGCCACTGAATATCCACACACTGCCCCATATTTTTTCAGCTCTGTCACCGGCGATCGCC
CCCGTTCTGGCTGATGGAGACAACAACAGACTCTTCCACGGACAAAAACGTCCCGAGCGCCGTGTCGCAC
TAACCCCCGAAGTCTTTGTGGAGCAGAACAACCTTATCCGCAACATGCAGCTCGATGTTGCGTCCACACG
CCAGTGCTTCATGGCGCAACTGGGGCAACCACTGACCAGCTGGAAAGACATGGCCCCACATGAAAAAGCG
CTCTTTGCCATCTTTGGCCTGCAGTTCTTCCTCGGTGACCGGAAAGCAGCGGTAGCCCTGATGAACAACC
TCAATCTCTCCTGCAGGCTCAAAAGTAAACGGGACCAGGGGCGTTTCAGCACGCCGGTGTATTCACTGGC
CAGAAACGCCTTTATCCGGGTCATCAAAACAGAAGGCGCACAACAGTGGCTCAGGCAGCACCGTTACGTT
CGCAGCGGTCTGGTCTGGCTTTACGCACATGATTTGCGCCTGACGCCTCCGAACTGGCTGTGGCTCAAGG
GCGTTGACCGGACGCTCTTCTATGCCCTTCACCGGGCAAACACCACAAAAGGCTTCATCGAAAGGGCCGG
CGTTGTGGCCGTTGCCCGGGCAAAAAATGAAGCCAGCCGTCTTGGGCTCCCCTGCCCGGAACCCTGTGTG
GAAGAGGCCATTGAAGGGTTTCGACGGGACATGTTGGGGCTTGGCCTGATATGGGACGAACCTCAGCCAG
ATCGCGATTGTAAACGTCAGATCAGGACCCGCTGGTCACTCACGGATGACGTGATACCCCGCCGCCATGA
TAACGACGAAGACACTGACACTGGTGAAACCACCGAAACCACCGAAACCACCGAAACCACCGAAACCACC
GAAACCACCGAAACCACCGAAAAACAGCATCCCGCCGACAAGGAAAAAGAACAATGA