SecReT4
Protein ID: 317054649
T4SS name [ID]Tra_I [164]
Gene symboltrbB
Locus tagp3521_p060
StrainEscherichia coli plasmid p3521 (NC_014843)
Repliconplasmid p3521 [GenBank: NC_014843] [Browse all T4SS(s) in this replicon]
Location [Strand]56047..57171 [+]
ProductTrbB
Component typeTrbB_I
UniProt IDE7BTB7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Thioredoxin_2 [PF13098], Evalue: 4.5e-06, Aligned region: 222..337
Protein Sequence: 374 a.a.     [Download]
>gi|317054649|ref|YP_004119716.1| TrbB [Escherichia coli]
MTIHYTATLNNKHLSLIALYPDGNREVIAILPVTELGALINRNNRLMHLSFSSPFREITETVLVDTVDAE
RPGHHIGRMLSAIDACLDAEYAGKGKHPSRKNGFWRTLMCGFIAGIALPATVAGYHWMKAEPPSTLAYPT
SQEWRAEPVTDTETPRPHTEHHVNSIPARPAPTQQEPSSAPAPTAVTEEQHVQAAEARRNLATVLKRNAD
RGMFTINLSTGHERTLYAFLDPACINCRLLEPALKQLAREFSVVIYPVSVIGGESSTKRTAPLLCEPDSQ
KRATGWHQLYSADSGMAPTGDAPAAQDGQCLTAARAAIDVNNQAFRQFGFGGTPWVLSDTGWHLPSGILK
DATSVRLFLKATDSEEYHNEPAPR
 
Nucleotide Sequence: 1125 bp     [Download]
>gi|317054589|ref|NC_014843.1|:56047-57171 Escherichia coli plasmid p3521, complete sequence
ATGACCATCCACTACACTGCAACACTGAATAATAAACACCTGTCCCTGATCGCCCTGTACCCTGACGGTA
ATCGGGAGGTGATTGCCATCCTGCCAGTCACAGAACTGGGCGCACTGATTAACCGTAATAACAGGCTGAT
GCACCTGTCCTTCAGTTCCCCTTTTCGCGAAATAACCGAAACGGTGCTTGTTGATACCGTTGATGCAGAA
CGTCCCGGACATCACATCGGCAGAATGCTCTCAGCGATTGATGCCTGCCTGGATGCCGAATATGCCGGAA
AAGGAAAACATCCCTCCCGGAAAAATGGCTTCTGGCGGACACTGATGTGTGGCTTTATCGCCGGAATTGC
TCTGCCGGCGACAGTTGCAGGTTACCACTGGATGAAGGCAGAGCCCCCTTCCACGCTGGCTTACCCTACA
TCTCAGGAATGGAGAGCTGAACCAGTAACCGACACAGAGACACCACGCCCACATACGGAACATCATGTTA
ACAGCATCCCGGCCCGCCCGGCTCCCACACAGCAGGAACCTTCTTCTGCCCCCGCCCCGACGGCAGTGAC
GGAAGAACAACACGTTCAGGCCGCTGAGGCCCGCCGTAATCTGGCCACAGTACTTAAACGCAACGCAGAC
CGGGGGATGTTCACCATTAACCTGTCCACTGGTCATGAACGCACGCTGTACGCCTTCCTTGACCCCGCAT
GCATCAACTGCCGTCTGCTGGAACCCGCGCTTAAGCAACTGGCCCGGGAATTCAGCGTGGTGATTTATCC
GGTCTCCGTGATTGGCGGGGAGTCCAGTACAAAGCGGACTGCTCCGCTGCTGTGTGAACCGGACTCACAA
AAACGGGCGACCGGATGGCATCAGCTGTATTCCGCTGACAGTGGTATGGCCCCCACCGGCGATGCACCGG
CCGCACAGGATGGACAGTGTCTGACCGCCGCACGTGCTGCCATCGATGTCAATAACCAGGCTTTCCGCCA
GTTCGGTTTTGGCGGAACCCCCTGGGTGTTATCAGATACCGGCTGGCACCTGCCGTCCGGCATCCTGAAA
GACGCCACTTCCGTTCGCCTCTTCCTGAAAGCAACAGATAGCGAGGAGTATCACAATGAGCCAGCACCAC
GTTAA