SecReT4
Protein ID: 317054650
T4SS name [ID]Tra_I [164]
Gene symboltrbC
Locus tagp3521_p061
StrainEscherichia coli plasmid p3521 (NC_014843)
Repliconplasmid p3521 [GenBank: NC_014843] [Browse all T4SS(s) in this replicon]
Location [Strand]57152..59455 [+]
ProductTrbC
Component typeTrbC_I
UniProt IDE7BTB8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraG-D_C [PF12696], Evalue: 3.4e-06, Aligned region: 437..525
Protein Sequence: 767 a.a.     [Download]
>gi|317054650|ref|YP_004119717.1| TrbC [Escherichia coli]
MSQHHVNPDLIHRTAWGNPLWNALHNLNITGLCLAGSIITALIWPLALPVCLLFTLVTSVIFMLQRWRCP
LRMPMTLSLDDPSQDRKVRRSLFSFWPTLFQYEADETFPARGIFYVGYRRINDIGRELWLSMDDLTRHVM
FFATTGGGKTETTFAWLLNPLCWGRGFTFVDGKAQNDTPRTIWFFSRRFGREDDIEFFNFMNGGKSPSEI
IQSGKKSRPQSNTWKPFPLRTEAFPAEKIQSMVPQNVQGGEWQSRAIAMNKALVFGTKFWCVREGKTMSL
QMLREHMTLEGMAKLYCRGLDDQWPEEAIAPLRNYLQDVPGFDMSLVRTPSAWTEEPRKQHAYLSGQFSE
TFTTFAETFGDVFAADAGDIDIRDSIHSDRILIVMIPALDTSAHTTSALGRMFVTQQSMLLARDLGYRLE
GTDAQTLEVKKYKGSFPYICILDEVGAYYTDRIAVEATQVRSLEFSLIMTAQDQERIEGQTSATNTATLM
QNAGTKFAGRIVSDDKTARTVKNAAGEEARARMGSLQRHDGVMGESWVDGNQITIQMESKIDVQDLIRLN
AGEFFTVFQGDVVPSASVYIPDSEKSCDSDPVVINRYISVEAPRLERLRRLVPRTVQRRLPTPEHVSSII
GVLTAKPSRKRRKNRTEPYRIIDTFQRQLATAQTSLDLLPQYDTDIESRANELWKKAVHTINNTTREERR
VCYITLNRPEEEHSGPEDIPSVKAILNTLLPLEMLLPVPDLTASPPHKKNVAQTPSGGKQESRKKRF
 
Nucleotide Sequence: 2304 bp     [Download]
>gi|317054589|ref|NC_014843.1|:57152-59455 Escherichia coli plasmid p3521, complete sequence
ATGAGCCAGCACCACGTTAATCCTGACCTCATACACCGCACGGCCTGGGGAAACCCGTTGTGGAATGCAC
TGCATAACCTGAACATCACTGGTCTGTGTCTGGCCGGCAGTATCATTACGGCGCTGATATGGCCACTGGC
CCTTCCTGTCTGCCTGCTGTTCACCCTGGTCACCTCCGTGATATTCATGCTGCAACGCTGGCGATGCCCC
CTGCGTATGCCCATGACACTCAGCCTTGATGACCCCTCCCAGGACAGAAAGGTCAGGAGAAGCCTCTTCA
GCTTCTGGCCCACCCTGTTTCAGTATGAAGCGGATGAAACATTCCCCGCCCGGGGGATTTTTTATGTCGG
TTACCGCCGTATCAACGATATCGGTCGTGAGCTCTGGCTGAGCATGGATGACCTCACCCGGCATGTCATG
TTTTTTGCCACCACCGGTGGCGGTAAAACAGAAACCACCTTTGCCTGGCTGCTCAACCCGCTCTGCTGGG
GAAGAGGCTTTACCTTTGTTGACGGAAAGGCACAGAACGATACCCCGAGGACAATCTGGTTTTTCTCCCG
ACGTTTTGGCAGGGAGGATGATATCGAATTCTTCAACTTCATGAACGGCGGAAAATCCCCCAGTGAAATT
ATTCAAAGCGGCAAAAAATCCCGCCCACAGTCAAACACCTGGAAACCGTTTCCATTAAGAACCGAAGCCT
TTCCCGCCGAAAAAATCCAGTCAATGGTGCCCCAAAACGTTCAGGGCGGTGAATGGCAGTCACGGGCGAT
AGCCATGAACAAGGCCCTGGTCTTTGGCACAAAATTCTGGTGCGTCCGGGAAGGTAAAACCATGTCCCTG
CAGATGTTACGGGAACATATGACGCTGGAAGGGATGGCAAAACTCTATTGCCGTGGCCTTGATGACCAGT
GGCCGGAAGAAGCTATCGCACCACTGCGAAACTACCTGCAGGATGTCCCGGGATTCGATATGTCACTGGT
GAGAACGCCGTCAGCCTGGACTGAGGAGCCCCGTAAACAGCATGCTTATCTCTCCGGTCAGTTCTCGGAA
ACGTTCACAACCTTTGCCGAAACCTTCGGGGACGTCTTTGCGGCAGATGCCGGCGACATCGATATTCGCG
ACAGTATTCACAGCGACCGCATTCTGATTGTGATGATCCCTGCACTGGACACATCGGCTCATACCACGTC
GGCACTCGGTCGTATGTTCGTCACCCAGCAGAGCATGCTCCTCGCCCGTGACCTGGGCTACCGGCTGGAA
GGCACAGATGCACAGACCCTGGAAGTCAAAAAATACAAAGGCAGCTTCCCCTATATCTGTATCCTTGACG
AAGTCGGTGCCTACTACACAGACCGCATTGCTGTGGAGGCCACCCAGGTACGTTCACTGGAGTTTTCCCT
GATAATGACGGCGCAGGATCAGGAGCGAATTGAAGGGCAGACCTCCGCCACCAACACCGCCACACTGATG
CAGAACGCCGGCACCAAATTCGCCGGACGCATTGTCAGTGACGACAAAACGGCAAGAACGGTGAAAAATG
CCGCCGGTGAAGAGGCACGGGCCAGAATGGGCAGCCTGCAGCGCCACGATGGTGTGATGGGTGAGTCCTG
GGTGGACGGTAACCAGATCACCATCCAGATGGAAAGCAAAATCGACGTGCAGGATTTGATCAGACTGAAT
GCCGGTGAGTTCTTTACCGTTTTCCAGGGGGATGTGGTGCCGTCAGCCTCTGTGTATATTCCGGACAGCG
AGAAAAGTTGCGACAGTGATCCGGTGGTCATCAACCGCTATATTTCCGTTGAAGCCCCCCGGCTGGAGCG
TCTCCGCCGTCTCGTCCCCAGGACAGTGCAGCGCAGGCTCCCCACACCGGAGCATGTCAGCAGCATCATC
GGTGTACTGACAGCAAAACCATCCCGTAAACGTCGTAAAAACCGTACAGAGCCTTACCGTATCATTGATA
CATTCCAGCGCCAGTTGGCAACAGCGCAGACATCACTGGATCTGCTTCCGCAATATGATACAGATATCGA
ATCCCGGGCAAACGAACTGTGGAAAAAGGCTGTGCACACTATCAATAACACAACCAGGGAAGAACGCCGG
GTATGTTATATCACACTGAATCGTCCGGAAGAGGAACACTCCGGTCCTGAAGATATACCTTCAGTGAAGG
CGATTCTGAATACTCTGCTCCCCCTGGAGATGCTGTTACCTGTACCGGATCTAACTGCATCCCCGCCCCA
TAAAAAAAATGTCGCTCAGACACCATCAGGTGGAAAACAAGAGAGTCGTAAAAAAAGATTCTGA