SecReT4
Protein ID: 32470220
T4SS name [ID]Tra_I [173]
Gene symboltraY
Locus tagR64_p089
StrainSalmonella enterica subsp. enterica serovar Typhimurium plasmid R64 (NC_005014)
Repliconplasmid R64 [GenBank: NC_005014] [Browse all T4SS(s) in this replicon]
Location [Strand]77716..79953 [-]
Productintegral membrane protein
Component typeTraY_I
UniProt IDQ79VV0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 745 a.a.     [Download]
>gi|32470220|ref|NP_863444.1| integral membrane protein [Salmonella enterica subsp. enterica serovar Typhimurium]
MSPSPLIKSCVAFAHTQFYSGVTVKILLRALCAGLAISSLPAMASVTYQDIVSAATNPDDLSRQALVTIF
GDVVTNPLSTSAPTLIGSMFGAFNSIIAVLAVVWFMFIGIRHVVRSGHQGQVFSTGRDIVGTLSVVAGFL
MIVPTGNGWSIAQLIMLWGASIMGVGSANVMVQLAADNIANGYSMTVQPVQASTRTAARGIFEMELCKYA
VNAGLNDFNQTAKSSTSLMTESAKTASGNYTVTVSNGSGICGSASLSVEGNGTTDQSTIGKFFNPFSKNE
YSGVISAQRAAMDNMISDMDNAASEFVTTFLEKRNSGNGTLPDIETRIQKVADEYERAVQKSLPTDNGEQ
SRKEALKSYLTTYGWVTLGAWYQTFATANQRLAELADRAPAVTSMSSLGEVGDTDLFSAVMSAYRTQLQN
SSYTPPLGTVVSSSEQRMANAQDPKSALSEIMGPLVSLTNRIATETSGTGTTSAQINPLIKMKNIGDITM
VSAEGIWTIYTTARVVVAGGKDSILVKFFNSLTGAASMLTALFEALAPPVYFLLFLMFCAGFSLSIYLPF
IPFIFWMTGIGNWIVSVLIGCTAGPLWAATHLGTSEDRGSRAAYGYIYLIDSMIRPPIMVFGFFFASVAI
IAVGTILNALFGAALVNVQFNSLTGIFSLAGFLLIYARICTTTVAAIFALQAYLPDHVINFLGGRDGANT
LGSMANSVKEIFIGGSRNIRHTPGMKTDRLKDNTKGSDDKDGIKG
 
Nucleotide Sequence: 2238 bp     [Download]
>gi|32470134|ref|NC_005014.1|:c79953-77716 Salmonella enterica subsp. enterica serovar Typhimurium plasmid R64, complete sequence
ATGTCGCCATCCCCCTTAATTAAATCCTGTGTGGCCTTTGCCCATACGCAATTCTATTCCGGAGTTACTG
TGAAAATTTTACTTCGCGCACTCTGTGCAGGCCTTGCTATATCCTCACTGCCGGCAATGGCTTCAGTGAC
CTATCAGGATATTGTGTCTGCCGCCACCAATCCTGACGATCTGTCCCGCCAGGCGCTGGTCACGATATTC
GGTGATGTAGTCACCAATCCACTGTCAACCAGCGCCCCCACTCTGATCGGAAGCATGTTCGGGGCGTTCA
ACAGTATCATCGCCGTACTTGCCGTTGTCTGGTTTATGTTCATTGGTATCCGTCATGTTGTGCGTTCGGG
GCATCAGGGACAGGTATTCAGCACCGGACGCGATATCGTCGGCACACTGAGTGTCGTTGCAGGTTTTCTG
ATGATCGTTCCAACCGGAAATGGCTGGAGTATCGCTCAGCTCATTATGTTATGGGGCGCATCGATAATGG
GGGTTGGGTCCGCCAATGTGATGGTGCAACTTGCCGCTGATAATATCGCAAATGGTTATTCAATGACTGT
ACAGCCAGTTCAGGCATCCACACGAACAGCAGCGCGTGGCATTTTTGAAATGGAACTGTGTAAGTATGCG
GTTAACGCAGGACTAAATGATTTTAATCAGACGGCCAAATCCTCGACTTCACTGATGACAGAATCAGCTA
AAACCGCCAGTGGTAATTACACTGTCACGGTATCCAATGGCAGCGGTATCTGTGGTTCAGCCAGCCTGTC
AGTAGAAGGAAACGGAACAACAGATCAATCGACGATTGGAAAATTCTTTAATCCCTTCAGTAAAAACGAA
TACAGCGGTGTTATCTCAGCACAACGTGCAGCCATGGATAATATGATTAGCGACATGGACAACGCTGCCA
GTGAGTTTGTGACAACATTTCTGGAAAAAAGAAATTCTGGCAACGGAACACTGCCGGATATCGAGACACG
AATTCAGAAAGTAGCCGACGAATACGAACGTGCTGTGCAAAAATCGCTACCCACTGATAACGGAGAGCAA
TCCAGAAAAGAGGCTCTTAAATCTTATCTCACAACCTACGGGTGGGTAACGCTTGGCGCATGGTATCAGA
CCTTTGCCACTGCTAACCAGCGTCTGGCAGAGCTGGCTGACAGAGCTCCAGCTGTAACTTCAATGTCATC
ACTGGGAGAAGTTGGTGATACTGACTTATTCAGTGCGGTCATGAGTGCCTATAGGACGCAACTGCAGAAT
TCCTCCTATACGCCACCGCTGGGCACAGTAGTATCATCCAGTGAACAACGCATGGCAAATGCACAAGATC
CGAAATCTGCCTTGTCTGAAATTATGGGCCCCCTTGTTAGTCTCACTAACAGGATTGCAACGGAAACAAG
TGGCACAGGCACAACCAGTGCTCAAATTAATCCTCTGATAAAAATGAAAAATATCGGAGATATAACAATG
GTAAGTGCAGAAGGAATCTGGACTATATATACAACGGCCAGAGTTGTCGTTGCCGGTGGCAAAGATTCAA
TTCTTGTAAAATTCTTTAACTCACTAACAGGTGCCGCTTCGATGCTTACCGCGCTGTTTGAAGCACTTGC
ACCACCTGTTTATTTTCTTTTGTTCCTGATGTTCTGTGCTGGATTTTCCTTATCAATTTACCTGCCATTC
ATTCCGTTTATTTTCTGGATGACAGGCATCGGGAACTGGATAGTCAGCGTATTAATAGGATGTACCGCCG
GGCCGCTGTGGGCTGCAACACATCTCGGGACATCAGAAGACAGAGGAAGTCGGGCAGCCTACGGTTATAT
ATACTTAATTGATAGTATGATAAGGCCGCCCATCATGGTCTTTGGTTTTTTCTTTGCTTCTGTAGCCATC
ATCGCCGTAGGCACAATACTGAATGCATTATTTGGCGCTGCCCTGGTTAACGTACAGTTCAATTCGCTGA
CCGGTATTTTCAGTCTTGCTGGTTTCTTGCTGATATACGCCAGAATTTGTACAACCACTGTAGCTGCCAT
ATTTGCCCTTCAGGCCTACCTACCTGATCATGTTATTAACTTCCTAGGGGGACGTGATGGAGCCAACACG
CTTGGCAGCATGGCAAATTCTGTTAAAGAAATATTTATTGGAGGAAGTCGCAATATCCGACATACTCCTG
GAATGAAAACAGATCGTCTTAAAGATAATACAAAAGGAAGTGACGACAAGGACGGAATAAAAGGATAA