SecReT4
Protein ID: 326326054
T4SS name [ID]Tra_F [513]
Gene symbol-
Locus tagVIBNI_0122
StrainVibrio nigripulchritudo plasmid VIBNI_pA (NC_015156)
Repliconplasmid VIBNI_pA [GenBank: NC_015156] [Browse all T4SS(s) in this replicon]
Location [Strand]132752..135331 [-]
ProductPutative conjugative transfer protein TraC
Component typeTraC_F
UniProt IDF0V150
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1e-42, Aligned region: 454..749
TraC_F_IV [PF11130], Evalue: 8.6e-42, Aligned region: 21..255
TrwB_AAD_bind [PF10412], Evalue: 2.4e-05, Aligned region: 452..516
Protein Sequence: 859 a.a.     [Download]
>gi|326326054|ref|YP_004250863.1| Putative conjugative transfer protein TraC [Vibrio nigripulchritudo]
MHSQGPLGTLSAFFKDAKRHQNHLHQELPYRTFDDTTAFFHNLTSTGMGFKLGVLGGANDEFIHSLNKLV
SELPQGDKWDYQLTLFGHHRTAQYIEENEAALSVRGGLCEKLAKQESEYAKYAACQGFFHRQSHRFDLRD
YDAYFFVSTVEQDDDRLSDVRAAIETTFAQLGVAIERINGERLLTIVKDVLNFDPAQDRPKTSAYNPYEW
LNQQTLSPDTELLFHRGFSDIRHTSEEGNEVSTRLVNLGLTGTPDDFRLYALPECLASVRNVARHLTCPH
MLSLNFRQKITGKVESENNRKIGDLTKTVSSKLALIMPTAEDELTERRMLQKGLANREFTLSAMSMTLTL
FSTCQTHRRDTQAAKEAFSASGIDIKVQSMMQSQCLLSVLPFMMSEGFWSDSQIAGRVKTVKSLNLVNFF
PIIMDFKRRGPGVLLPTMRGQISYFDAFSCGSDNKNIALTGGSGAGKSFVVQQIAKTVYAKGGKVWILDK
GKSYKKLTLMLGGAYLDHTRIFLNPFTHLENVNRTKQDATQPYQDDQGTVVDPMKEALSNITALFATIAS
PYSELSAYQLAVLGDAIVQAWEAKGTVTQVDDVQHALFSLAKDNGDDSRIRDIAVQLNKFCRNGVYGDTF
NLPSMLDPDIDITTLELDGFNEDMLRPVMFALIVSINQQMYLSGDRSREKLCIIEEAWSLMSGANAQART
FINTGYRTTRKFGGAFCTVTQGMEDFFANAEAKACFDNSDIHLTLRQGEGFETFLTENPNYFSDLEQRVI
RSFPRASEAGYSCLRIKAGGVVSFHRVFADPFTRACLSTEPREYEYCESLMSQNTPLMEAIEKTARRFYG
RDIADYERHLKAEQEEKAA
 
Nucleotide Sequence: 2580 bp     [Download]
>gi|326325966|ref|NC_015156.1|:c135331-132752 Vibrio nigripulchritudo plasmid VIBNI_pA, complete genome
ATGCACTCTCAAGGACCATTAGGCACCCTGTCTGCCTTTTTCAAAGACGCTAAGCGGCATCAAAATCACC
TGCACCAAGAATTGCCGTATCGCACCTTTGATGACACCACCGCCTTTTTCCACAACCTGACGTCAACGGG
GATGGGATTCAAGCTGGGAGTATTAGGCGGAGCCAATGATGAATTCATCCACTCTCTCAACAAACTGGTC
TCTGAACTTCCCCAAGGCGACAAATGGGACTATCAACTGACGTTGTTCGGGCACCATCGGACTGCTCAGT
ACATTGAAGAAAATGAGGCTGCGCTGTCAGTCCGAGGAGGGCTTTGTGAAAAGCTGGCGAAGCAAGAGAG
TGAATACGCAAAGTACGCAGCGTGTCAGGGCTTCTTTCATCGGCAGTCACATCGATTCGACCTGCGAGAC
TACGACGCATACTTCTTTGTATCGACTGTAGAACAAGACGATGATCGCTTGTCGGACGTGCGCGCCGCTA
TTGAGACAACCTTTGCTCAGTTGGGAGTTGCCATTGAACGCATCAACGGGGAAAGGTTGCTGACGATCGT
TAAAGACGTACTGAATTTCGACCCCGCCCAAGATCGCCCGAAGACCAGTGCCTATAACCCGTACGAATGG
TTAAATCAGCAGACACTGTCCCCAGACACCGAACTGCTGTTTCATCGAGGTTTCTCCGACATTCGGCACA
CCAGCGAAGAAGGAAACGAAGTGTCCACTCGCCTGGTGAACCTTGGGCTGACGGGCACTCCTGATGATTT
TCGTCTCTACGCCCTCCCCGAATGCCTGGCCTCGGTACGCAATGTCGCCAGGCACTTAACCTGTCCCCAC
ATGTTGAGCTTGAACTTTCGGCAGAAAATAACGGGCAAGGTGGAAAGCGAGAACAATCGCAAAATCGGGG
ATCTCACAAAAACAGTCAGCTCCAAACTGGCTTTGATCATGCCAACCGCCGAAGACGAACTGACCGAGCG
CCGAATGTTGCAAAAAGGACTGGCTAATCGTGAATTCACGCTCAGTGCAATGTCGATGACATTGACGCTG
TTCTCCACCTGTCAGACCCACCGTCGGGACACGCAGGCAGCGAAAGAGGCATTTTCTGCTTCGGGTATCG
ACATCAAGGTCCAATCGATGATGCAGTCTCAATGCCTGCTGTCGGTCCTGCCCTTTATGATGAGCGAAGG
ATTTTGGTCAGACAGCCAGATCGCAGGTCGGGTCAAGACCGTTAAAAGTCTCAACCTCGTCAATTTCTTT
CCTATCATCATGGACTTCAAACGCCGGGGACCGGGTGTATTGCTGCCCACCATGCGAGGACAAATTTCTT
ATTTCGATGCGTTTTCCTGCGGCAGCGATAATAAGAACATCGCGCTCACAGGCGGCTCCGGAGCAGGCAA
GAGTTTTGTGGTTCAACAGATCGCCAAGACCGTTTACGCCAAGGGAGGCAAGGTATGGATTCTGGACAAA
GGAAAAAGTTATAAGAAACTCACACTAATGCTAGGGGGAGCGTACCTGGATCACACCCGCATTTTCCTCA
ACCCATTCACGCACCTCGAGAACGTCAATCGCACTAAGCAAGATGCGACCCAGCCTTATCAGGATGATCA
GGGCACGGTCGTCGACCCGATGAAAGAAGCCCTGAGCAATATCACGGCACTGTTTGCCACCATCGCTTCG
CCTTACTCGGAGCTTTCCGCCTATCAACTTGCGGTCCTAGGAGACGCCATTGTTCAGGCTTGGGAAGCCA
AAGGTACAGTAACTCAAGTTGATGATGTGCAACACGCCTTGTTCAGTCTGGCGAAAGACAACGGCGACGA
CAGCCGGATCCGAGACATTGCGGTGCAACTCAATAAATTCTGTCGCAATGGGGTGTATGGGGACACCTTT
AACCTGCCTTCCATGCTTGATCCCGACATCGACATCACCACATTGGAGTTGGATGGGTTTAACGAAGACA
TGTTGCGCCCCGTGATGTTCGCGTTGATCGTGTCCATCAACCAGCAAATGTATTTATCGGGAGATCGCAG
CCGAGAAAAGCTGTGCATCATAGAGGAAGCGTGGAGTCTGATGAGCGGCGCTAATGCCCAGGCTCGCACG
TTCATCAACACCGGGTATCGCACGACCCGAAAATTTGGAGGGGCTTTTTGCACCGTGACTCAGGGCATGG
AAGACTTTTTTGCCAATGCAGAGGCTAAGGCGTGCTTTGACAATTCAGACATCCACCTAACGCTCCGACA
AGGCGAGGGTTTTGAAACCTTCCTGACGGAAAACCCAAACTACTTCAGTGATCTGGAACAACGTGTCATC
CGAAGCTTCCCGCGCGCCAGCGAAGCGGGCTACAGCTGCCTGCGCATCAAAGCCGGTGGTGTCGTCAGCT
TTCATCGGGTCTTTGCGGATCCGTTCACTCGGGCGTGCCTGAGTACAGAGCCACGTGAGTACGAGTACTG
TGAATCGTTGATGTCGCAAAATACCCCTCTGATGGAAGCCATCGAGAAAACGGCGCGCCGATTTTACGGC
AGAGACATTGCGGATTACGAACGGCATCTGAAAGCAGAGCAAGAGGAGAAAGCGGCATGA