SecReT4
Protein ID: 326326056
T4SS name [ID]Tra_F [513]
Gene symbol-
Locus tagVIBNI_0124
StrainVibrio nigripulchritudo plasmid VIBNI_pA (NC_015156)
Repliconplasmid VIBNI_pA [GenBank: NC_015156] [Browse all T4SS(s) in this replicon]
Location [Strand]135744..137231 [-]
ProductPutative conjugative transfer protein TraB
Component typeTraB_F
UniProt IDF0V152
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 6.7e-33, Aligned region: 236..434
Protein Sequence: 495 a.a.     [Download]
>gi|326326056|ref|YP_004250865.1| Putative conjugative transfer protein TraB [Vibrio nigripulchritudo]
MSGNWKKRWFSDPEGSFSQGDQVNQKTLKRNHLITSFAFLILTVGTLCLYRFMQPAKATATPVTQAAFTS
IIDADFTEKDNQSALSQQHAMLLKLTQSLSQVSSALSTLTEEVDKRIEDTYTRAAKETEARLQALHQQKR
QTATPSPTSTPSSQPKVPPVTDPKATSPQPVNSAETFGARSLPPRPASQTGDQAKAQEFRYRPQGSAATP
NLAFDSHDFTWEASDTDVQPRSTASYVPSGTFVTARITGGGDANAGVLGQGDTIPLVLQTLNKGILPNGE
TSHLKDCTITASAYGEVSSSRGIVRTNRMSCIQDGGQILDVSIEGTAFNFGRNGVRGTTILKNGKIVEMA
GISGILTGLGETGQALSQTTSTSALGSTQTVSGQNAALNLLGSAGSSVGAKLADYYIKLAELYHPIIEIN
PGTIVNIVFLKGFPLDPVLARREELRREEATAVAQSNRALDIVTTPPLNPIARELKQQGITATPTPFGQP
SGGTQ
 
Nucleotide Sequence: 1488 bp     [Download]
>gi|326325966|ref|NC_015156.1|:c137231-135744 Vibrio nigripulchritudo plasmid VIBNI_pA, complete genome
ATGTCAGGTAACTGGAAAAAGCGCTGGTTCAGCGATCCGGAGGGATCTTTTTCTCAAGGCGATCAAGTCA
ATCAGAAAACCCTTAAGCGCAACCATCTCATCACTTCCTTTGCGTTCCTGATACTGACCGTTGGGACGTT
GTGCCTGTACCGGTTCATGCAGCCCGCAAAAGCCACTGCCACACCGGTCACCCAAGCGGCATTTACGTCC
ATAATTGATGCTGACTTTACTGAAAAAGACAACCAGAGCGCCCTCAGTCAGCAGCATGCCATGCTCCTTA
AGCTCACTCAGTCCTTGTCTCAGGTATCGTCCGCTCTGAGCACGTTAACCGAAGAGGTCGACAAGCGCAT
AGAAGACACCTACACGCGAGCCGCCAAAGAAACCGAAGCGCGTTTGCAGGCACTGCACCAGCAAAAACGC
CAGACGGCAACACCATCACCAACGTCCACACCATCGAGTCAGCCCAAAGTGCCCCCCGTGACCGACCCTA
AAGCGACTTCACCTCAACCGGTGAACTCTGCAGAAACGTTCGGAGCACGCTCTCTGCCTCCTCGCCCTGC
TTCGCAGACAGGGGATCAGGCAAAAGCTCAAGAATTTCGCTACCGCCCTCAAGGTTCCGCTGCAACGCCC
AACCTGGCTTTTGACAGCCACGATTTCACGTGGGAAGCCTCAGATACAGATGTTCAGCCCCGTTCGACAG
CCAGTTATGTACCCAGCGGAACTTTCGTCACCGCAAGAATCACCGGAGGCGGTGATGCCAATGCCGGTGT
ATTGGGTCAGGGAGACACCATTCCCCTGGTGCTACAAACCCTGAACAAAGGCATTCTGCCGAATGGTGAA
ACCTCTCATCTGAAGGACTGCACCATCACCGCATCGGCGTACGGCGAGGTGTCATCAAGCCGCGGTATCG
TTCGAACCAACCGGATGAGTTGCATTCAGGACGGAGGACAAATCTTGGACGTCTCCATCGAAGGGACGGC
ATTCAATTTCGGGCGAAACGGGGTGCGAGGAACCACCATTTTAAAAAACGGCAAAATCGTTGAAATGGCA
GGCATCTCTGGAATATTGACCGGACTCGGAGAGACCGGGCAAGCCCTGTCTCAGACTACCTCCACATCCG
CTTTGGGATCCACCCAGACCGTGTCCGGTCAAAATGCGGCGTTGAACCTTTTAGGCAGCGCAGGCAGTTC
GGTTGGTGCAAAGCTTGCCGACTACTACATCAAACTGGCGGAGCTCTACCATCCGATCATTGAAATCAAC
CCAGGAACCATCGTGAACATTGTCTTTTTAAAAGGGTTTCCGTTGGATCCGGTGCTTGCAAGACGCGAAG
AGCTTAGACGCGAGGAAGCGACTGCGGTGGCTCAGTCTAATCGAGCACTCGACATCGTGACGACCCCGCC
CCTCAACCCCATCGCTCGAGAACTTAAACAACAGGGGATCACCGCCACACCGACGCCATTTGGTCAGCCT
TCAGGAGGTACACAATGA