SecReT4
Protein ID: 330808760
T4SS name [ID]Tfc [724]
Gene symbol-
Locus tagPSEBR_a1992
StrainPseudomonas brassicacearum subsp. brassicacearum NFM421
Repliconchromosome [GenBank: NC_015379] [Browse all T4SS(s) in this replicon]
Location [Strand]2431509..2433014 [-]
Producthypothetical protein
Component typeTfc19
UniProt IDF2KEZ2
KEGG IDpba:PSEBR_a1992
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 1.7e-122, Aligned region: 10..487
Protein Sequence: 501 a.a.     [Download]
>gi|330808760|ref|YP_004353222.1| hypothetical protein PSEBR_a1992 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
MTLYTNDYLEYYLTLVGWIVNNGIWELLVASGVFTLPFLAIIIQEWLRARSEGADEGNKGLLSSLRIENR
VWVAIVVIMFAGIPFFPVDLNTIEFDSTRSTQCQVSVAAPQDTRWSSTFTTLNNQSAKVPVWWFFMHSLS
KAITGGSIAAIPCGTDLRQIRMDIDATRIDDPILAQEVVDFSQDCYGPARARMFMNRPSLSDEKMDDINW
IGSKQLVSTSGYYDRYHSKTPRSRWPFNTARDAGLAQVPGGGGYPTCKQWWSDAGVGLRARLVQQIDPSL
LTRLSNWARFLSRTESDDAVIRSVVSPRQQTLNQGQVYSSYGGQIDMSASNMLARGASDLGMTVGSLAFF
PGMDVVRQALPMVLSFLKAALIICIPLILVIGTYELKALVTISCVQFALFFVDFWFQLARWLDSTILEAL
YGWNSPHSNFNVLMGINNSFGDMLLNYVMATMFLILPTLWISALSWVGMRAGGVIQGLSQGGSDAQAAGA
RGADIAKRMIL
 
Nucleotide Sequence: 1506 bp     [Download]
>ref|NC_015379.1|:c2433014-2431509 hypothetical protein PSEBR_a1992 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
ATGACGCTCTACACCAACGACTATCTGGAGTACTACCTGACCCTGGTCGGGTGGATCGTCAACAACGGCA
TCTGGGAGCTGCTCGTTGCCAGCGGCGTATTTACCCTGCCCTTCCTTGCCATCATCATCCAGGAATGGCT
CAGGGCACGAAGTGAAGGTGCCGATGAGGGCAACAAGGGCCTCCTGTCCTCCTTGCGCATCGAGAACCGA
GTGTGGGTCGCTATTGTCGTAATCATGTTTGCGGGTATTCCCTTCTTTCCGGTGGACCTGAACACGATCG
AGTTCGACAGTACTCGCTCAACGCAATGTCAGGTCAGCGTCGCCGCTCCGCAAGACACTCGCTGGTCCAG
CACCTTTACCACCCTCAATAACCAAAGCGCCAAAGTGCCGGTGTGGTGGTTCTTCATGCACTCGCTTTCA
AAAGCCATCACCGGTGGATCTATTGCGGCAATCCCCTGTGGAACAGATCTGCGGCAGATTCGCATGGACA
TTGACGCAACACGCATCGACGACCCGATATTGGCTCAGGAGGTCGTTGATTTCAGCCAAGACTGCTACGG
CCCGGCACGCGCGCGAATGTTCATGAATCGTCCGAGCCTGAGCGACGAGAAGATGGACGACATCAATTGG
ATTGGGTCGAAGCAGTTGGTCAGCACCAGTGGATACTACGATCGATATCACTCCAAAACCCCTCGCAGCC
GTTGGCCTTTCAATACTGCGCGAGATGCAGGACTGGCCCAGGTTCCTGGTGGCGGCGGTTACCCCACGTG
CAAGCAATGGTGGTCAGATGCAGGTGTTGGTTTGCGAGCCAGGCTGGTGCAGCAGATCGATCCAAGCCTG
CTAACTCGCCTCAGCAACTGGGCACGCTTCCTGAGCAGAACTGAGTCCGATGACGCAGTCATTCGATCCG
TCGTATCACCGCGCCAACAGACATTGAACCAAGGCCAGGTCTACTCCAGCTACGGAGGCCAGATCGACAT
GTCTGCCTCGAACATGCTTGCTCGCGGAGCCTCAGATTTGGGCATGACGGTCGGCTCACTGGCCTTCTTC
CCTGGGATGGACGTAGTACGCCAAGCCCTTCCCATGGTGCTGTCCTTTTTGAAGGCTGCGCTGATCATTT
GCATTCCCTTGATCTTGGTGATCGGGACCTACGAACTCAAAGCCTTGGTTACCATAAGCTGTGTCCAGTT
CGCTCTCTTCTTCGTGGACTTCTGGTTTCAACTCGCTCGCTGGCTCGACAGCACGATCCTTGAAGCGCTG
TACGGCTGGAACTCCCCCCATAGCAATTTCAACGTGCTCATGGGCATCAACAACTCCTTTGGGGACATGC
TGCTGAACTACGTCATGGCGACAATGTTTTTAATCCTCCCCACATTATGGATTTCCGCACTGTCCTGGGT
CGGAATGCGAGCAGGAGGAGTAATTCAAGGTTTGAGTCAAGGTGGTTCAGACGCTCAAGCGGCAGGGGCC
AGAGGTGCCGATATAGCCAAGAGAATGATCCTGTAA