SecReT4
Protein ID: 330808763
T4SS name [ID]Tfc [724]
Gene symbol-
Locus tagPSEBR_m637
StrainPseudomonas brassicacearum subsp. brassicacearum NFM421
Repliconchromosome [GenBank: NC_015379] [Browse all T4SS(s) in this replicon]
Location [Strand]2434767..2435720 [-]
Producthypothetical protein
Component typeTfc23
UniProt IDF2KEZ5
KEGG IDpba:PSEBR_m637
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 1.3e-88, Aligned region: 31..301
Protein Sequence: 317 a.a.     [Download]
>gi|330808763|ref|YP_004353225.1| hypothetical protein PSEBR_m637 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
MLHLYSKPLRFIAVATAMGCPLSAFALNSATIIASSASPDCLAYRVVGVCYWLYCTNFGCEVETSTKVRH
YVPDAVVSSYSNTGENPWSDVRSMSSTNPSARGGGDGSPGIGHENDLAKFKNADVIGHPGGATFSQFAGQ
SGYACQGAGQILMPYFLSTLDSLAWRYNIPEMVFPEALTPGVREIGSRTSANLWGAIYPRGGFLHGVDDY
KCAAVIAQRAGDIITRRGQAHVYQPLLGTKQDGYWPAGPLKENDPSTGKWQELKPNQSKTCAVFPNTLPH
VQSPRGDYAWALWRPYSCCERKGQVFLGSTDFAGSNE
 
Nucleotide Sequence: 954 bp     [Download]
>ref|NC_015379.1|:c2435720-2434767 hypothetical protein PSEBR_m637 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
ATGCTCCATCTCTATTCGAAGCCATTGCGCTTTATCGCAGTTGCCACCGCAATGGGGTGCCCCCTATCGG
CGTTCGCCCTCAATAGTGCGACGATTATAGCCTCCAGCGCATCGCCCGATTGCCTTGCCTATCGTGTGGT
CGGCGTTTGCTATTGGCTTTACTGCACCAACTTCGGATGTGAGGTTGAAACCTCCACCAAGGTGCGTCAT
TACGTGCCTGACGCCGTGGTCTCCAGCTACAGCAATACCGGGGAGAATCCTTGGTCGGATGTTCGATCCA
TGAGCTCGACCAATCCGTCCGCCCGCGGTGGTGGTGACGGAAGCCCTGGCATCGGCCACGAAAATGATCT
CGCCAAGTTCAAAAATGCTGATGTGATCGGGCACCCAGGTGGCGCCACATTCAGCCAGTTCGCGGGACAG
TCCGGCTACGCCTGTCAGGGCGCAGGCCAAATCCTGATGCCCTATTTTCTGAGCACTTTGGACAGCCTGG
CCTGGCGCTACAACATACCTGAAATGGTGTTTCCCGAGGCCCTCACGCCAGGCGTGCGAGAGATAGGTAG
TCGCACCAGTGCAAATCTATGGGGAGCGATCTATCCCCGTGGTGGGTTCCTGCACGGCGTGGATGATTAC
AAATGTGCTGCTGTCATTGCACAACGAGCCGGAGACATCATCACGCGCCGTGGCCAGGCTCATGTTTATC
AGCCGCTATTGGGCACGAAACAGGATGGATACTGGCCAGCAGGTCCGTTAAAGGAAAACGACCCCAGCAC
CGGGAAATGGCAAGAGCTGAAACCCAACCAATCGAAAACCTGTGCTGTATTCCCAAACACCCTTCCCCAC
GTGCAATCACCTCGGGGAGATTACGCCTGGGCACTCTGGCGGCCGTATAGCTGTTGCGAACGCAAGGGAC
AGGTCTTTCTCGGCAGCACAGACTTCGCAGGTTCGAACGAATGA