SecReT4
Protein ID: 330808768
T4SS name [ID]Tfc [724]
Gene symbol-
Locus tagPSEBR_a1996
StrainPseudomonas brassicacearum subsp. brassicacearum NFM421
Repliconchromosome [GenBank: NC_015379] [Browse all T4SS(s) in this replicon]
Location [Strand]2439770..2442607 [-]
Producthypothetical protein
Component typeTfc16
UniProt IDF2KF00
KEGG IDpba:PSEBR_a1996
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 7.3e-68, Aligned region: 57..333
AAA_10 [PF12846], Evalue: 1.1e-45, Aligned region: 526..861
Protein Sequence: 945 a.a.     [Download]
>gi|330808768|ref|YP_004353230.1| hypothetical protein PSEBR_a1996 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
MTWFSQWKRKKESTVAAESNAWDEHIAKLAEHGISEPGLVRRRPTTEADDHAFYDLAPSFVDRLPWVEYL
PQSQCMLLEDGLSVAAFFELTPLGTEGRESTWLLQARDTLENILQDSFDELDNNPWVVQLYAQDETNWDG
YLQTLGQYLQPRACGSAFSEFYLRFFAHHLDAISKPGGLFEDTTLTRLPWRGQTRRVRMVVYRRVSKSVP
SRREHTPEQALSIVCERLTAGLTSAGIKTQRMGGDKIHNWLLRWFNPNPTHLGSSTSDRDRFYQLTTYPE
EVEEGEIELATGTDFAQRLFFSQPRSDVSEGVWYFNDMPHRVMLMDRLRTPPHTGHLTGETRKGDAINTY
FDQMPEDTLMCLTLVATPQDVLEAHLNHLSKKAVGDTLASEQTRQDVHQARSIIGSSHKLYRGSLAFYLR
GKDMAQLDSRSMQLANVMLSAGLQPVREDDEVAPLNSYLRWLPCVFDPAKDKRQWYSQLMFAQHVANLAP
VWGRSQGTGHPGITLFNRGGGTLCFDPLNRLDRQMNAHLFLFGPTGSGKSATLNNILNQITAVYRPRLII
VEAGNSFGLFADFARRLDLTVHHVRLSPGAGVSLAPFADARRLVETPDEIQTLDADRLDDTALPYEGDEQ
RDVLGELEITARLMITGGEDKEEARLTRADRSLIRQSILNAAQRCASEHRTVLTQDVRDALREQGADNGL
PEGRRTRLLEMAEAMDLFCQGLDGELFNRPGTPWPEADITIVDLATFAREGYNAQLSIAYLSLLNTVNNI
AERDQFLGRPIINVTDEGHIITKNPLLAPYVVKITKMWRKLGAWFWLATQNLDDLPKAAEPMLNMIEWWI
CLSMPPDEVEKIARFRELSPAQKALMMSARKESGKYCEGVVLSKSMEALFRAVPPSLYLAMAMTEPEEKA
ARFKLMQEHKISELDAAIHMAEDIDRARGIEPLQL
 
Nucleotide Sequence: 2838 bp     [Download]
>ref|NC_015379.1|:c2442607-2439770 hypothetical protein PSEBR_a1996 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
ATGACTTGGTTTTCTCAATGGAAACGTAAAAAGGAATCAACCGTCGCCGCTGAGTCAAACGCATGGGATG
AACATATCGCAAAGCTTGCCGAACATGGAATTTCCGAACCTGGGCTAGTGCGTAGAAGACCGACAACTGA
AGCCGATGATCATGCGTTTTATGACCTGGCGCCGTCTTTTGTCGATCGCCTGCCTTGGGTCGAATACCTA
CCACAGTCACAATGCATGCTCTTGGAGGACGGGCTGTCTGTCGCAGCCTTCTTCGAGCTAACGCCACTGG
GCACTGAAGGTCGTGAAAGCACTTGGTTGCTGCAAGCCCGAGACACTCTGGAAAACATCCTGCAAGACAG
CTTTGATGAGTTGGACAACAATCCATGGGTTGTACAACTCTACGCACAGGACGAAACCAACTGGGATGGG
TATCTCCAGACGCTGGGTCAGTACCTTCAACCGCGAGCTTGTGGCAGTGCCTTCAGCGAGTTTTACCTGC
GTTTCTTTGCACATCATCTCGACGCGATCTCCAAGCCTGGCGGGCTCTTCGAAGACACCACGCTGACTCG
CTTGCCTTGGCGCGGGCAGACCCGACGAGTACGAATGGTCGTGTACAGACGCGTGTCAAAATCAGTCCCA
TCGCGCCGAGAGCACACTCCCGAACAAGCATTGAGCATTGTTTGCGAGCGATTGACCGCTGGGTTGACGA
GCGCTGGTATCAAGACTCAGAGAATGGGAGGCGACAAGATCCATAACTGGTTATTGCGTTGGTTTAACCC
CAACCCGACGCACCTGGGCTCCTCAACATCGGATCGTGACCGGTTCTATCAACTGACGACTTACCCTGAG
GAGGTCGAAGAGGGGGAAATTGAGCTGGCTACCGGCACGGATTTCGCCCAACGTCTGTTCTTCAGTCAGC
CACGATCTGATGTGTCTGAAGGCGTTTGGTACTTCAACGATATGCCCCACCGGGTCATGCTGATGGACCG
ACTACGCACCCCTCCCCACACGGGACACCTGACTGGTGAAACGCGCAAAGGGGACGCAATCAACACATAC
TTCGATCAAATGCCTGAAGACACCCTGATGTGCCTGACGCTGGTTGCCACTCCGCAAGACGTCCTGGAGG
CCCACCTCAATCACCTGAGTAAAAAAGCTGTTGGCGATACCCTTGCCTCGGAACAGACACGCCAGGACGT
CCACCAAGCCCGATCAATTATCGGCAGTTCGCACAAGCTTTACCGAGGATCACTGGCCTTCTATCTACGC
GGTAAGGACATGGCGCAATTGGACTCCCGGAGCATGCAATTGGCCAATGTGATGCTCAGTGCTGGGTTAC
AGCCGGTGCGCGAAGATGACGAAGTTGCACCGCTTAACAGCTACCTGCGTTGGTTACCGTGTGTCTTCGA
CCCGGCCAAAGATAAGCGCCAGTGGTACAGCCAGCTCATGTTCGCGCAACACGTTGCCAATCTAGCCCCG
GTATGGGGCCGCAGTCAGGGAACGGGGCATCCGGGCATTACCTTGTTCAATCGTGGCGGCGGCACTCTGT
GCTTCGACCCTCTGAACCGCCTTGATCGTCAGATGAATGCTCATCTGTTTTTGTTCGGCCCTACAGGCTC
CGGAAAATCCGCGACGCTCAACAACATTCTGAACCAGATCACTGCTGTTTACCGGCCGCGGTTGATCATC
GTTGAGGCTGGTAACTCCTTTGGGCTGTTTGCCGACTTTGCAAGACGCCTGGATCTGACCGTACATCACG
TCAGGCTATCACCAGGTGCCGGCGTGAGCCTGGCTCCCTTTGCAGACGCTCGTCGCTTGGTGGAAACACC
GGATGAGATTCAGACGCTCGACGCCGACCGGCTGGATGACACAGCTCTGCCGTATGAGGGTGATGAACAA
CGTGATGTGTTGGGCGAGTTGGAGATCACTGCACGACTGATGATCACAGGAGGTGAGGACAAGGAAGAAG
CACGTCTTACGCGAGCGGATCGCAGCCTGATTCGCCAGAGCATTTTGAATGCGGCACAACGCTGTGCCAG
TGAGCACCGAACGGTGCTAACCCAGGATGTTCGAGATGCGCTGCGTGAACAAGGCGCAGATAACGGTCTA
CCGGAGGGGCGCCGTACTCGTCTTCTGGAAATGGCCGAAGCGATGGATCTGTTCTGCCAGGGGTTGGATG
GAGAACTGTTCAATCGCCCAGGAACTCCGTGGCCGGAAGCCGACATCACCATTGTCGATCTGGCCACCTT
CGCTCGCGAGGGCTATAACGCTCAACTCTCGATCGCGTATTTATCGCTGCTCAACACTGTTAACAACATA
GCCGAGCGGGACCAGTTCCTTGGACGTCCAATCATCAACGTCACCGATGAGGGACACATCATCACCAAGA
ACCCGCTGCTGGCTCCCTATGTCGTCAAGATCACCAAGATGTGGCGAAAGCTGGGGGCCTGGTTCTGGCT
GGCCACTCAGAATCTCGATGACCTACCCAAAGCCGCCGAACCAATGTTGAACATGATTGAGTGGTGGATC
TGCCTGAGCATGCCGCCTGATGAGGTGGAGAAGATCGCCAGGTTCCGGGAGCTCAGCCCCGCTCAGAAAG
CGCTAATGATGTCGGCACGAAAGGAGTCCGGAAAGTACTGCGAGGGCGTCGTGCTTTCAAAATCAATGGA
AGCGCTGTTTCGTGCGGTACCTCCGAGCCTGTACCTGGCCATGGCCATGACCGAGCCAGAAGAAAAAGCG
GCACGATTCAAGCTCATGCAAGAACACAAAATCAGTGAATTGGACGCAGCGATTCATATGGCTGAAGACA
TAGACCGAGCCCGAGGAATCGAACCGCTGCAACTCTAG