SecReT4
Protein ID: 330808769
T4SS name [ID]Tfc [724]
Gene symbol-
Locus tagPSEBR_cmegl42
StrainPseudomonas brassicacearum subsp. brassicacearum NFM421
Repliconchromosome [GenBank: NC_015379] [Browse all T4SS(s) in this replicon]
Location [Strand]2442607..2443032 [-]
Producthypothetical protein
Component typeTfc15
UniProt IDF2KF01
KEGG IDpba:PSEBR_cmegl42
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 141 a.a.     [Download]
>gi|330808769|ref|YP_004353231.1| hypothetical protein PSEBR_cmegl42 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
MSSRIWTEMIPVALLAAAVTGCATNTEELLSHNGNSMMDVWNQQTSGSRSGQAAQQLLDARQALRRPLTE
PLRSSSAMPYTRTAQIEIRQQFHRLPNPDLVMYVFPHWAGTESVPVPGYSTIFPLHQRVQYAMPGERLED
Y
 
Nucleotide Sequence: 426 bp     [Download]
>ref|NC_015379.1|:c2443032-2442607 hypothetical protein PSEBR_cmegl42 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
ATGTCGTCTCGGATTTGGACTGAAATGATACCGGTCGCGCTACTCGCCGCGGCAGTAACGGGCTGTGCGA
CTAACACCGAAGAGCTGCTCAGTCATAACGGCAATTCCATGATGGATGTCTGGAACCAACAAACCAGCGG
ATCACGGAGCGGACAAGCCGCTCAACAGCTACTGGACGCAAGGCAGGCGTTGAGACGACCTCTGACTGAA
CCATTGCGGTCCTCTTCTGCCATGCCTTACACCCGAACAGCTCAAATCGAGATCCGTCAGCAGTTTCATC
GTCTGCCCAATCCGGACTTGGTGATGTACGTCTTTCCTCATTGGGCCGGGACAGAGTCCGTACCTGTACC
AGGTTACAGCACCATTTTTCCGCTGCATCAACGCGTGCAGTACGCCATGCCTGGCGAACGTTTGGAGGAC
TATTGA