SecReT4
Protein ID: 330808770
T4SS name [ID]Tfc [724]
Gene symbol-
Locus tagPSEBR_a1997
StrainPseudomonas brassicacearum subsp. brassicacearum NFM421
Repliconchromosome [GenBank: NC_015379] [Browse all T4SS(s) in this replicon]
Location [Strand]2443010..2444446 [-]
Producthypothetical protein
Component typeTfc14
UniProt IDF2KF02
KEGG IDpba:PSEBR_a1997
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 478 a.a.     [Download]
>gi|330808770|ref|YP_004353232.1| hypothetical protein PSEBR_a1997 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
MKSNGLLKWLMIPMALLLVLVLAKLMPGKKVSPSDPIDSESRLTVEEMKALGLEGDTPSDTVATLVAQVR
QLRGELKNSLGDNERRDPGTDQLRQLEDTVEQRIQLALEKERQRIQEEQNALANDTSDIQGLLQSLQWQL
DNLRQEDSHLDVPVGMGQLEGAGQGFRDSIHWVEPDDAKPKDVAGSSAEPIFSFPTSFGPAQKTLGAIAD
SATSSASGSFDVPSAKPTYTVPPNATLMGSVAMTALIGRVPIDGTVNDPFPFKVLIGADNLTANGIDLPE
VAGAVISGTASGDWTLSCVRGQIRSITFVFQDGTIRTLPADNQSDSRGSSQHSSNSGATQEGLGWISDRH
GIPCVAGTRRSNAQQYLGSQALITAAGVGAASLIKSDGNTVYAGNSGGSLGTVGISGSEAMNRLLASGVQ
DISQWVNKLYGQAFAAVYVEPGAQVAVHIEQPLTLDYDAKGRKVDHTLGGRHVVSDLD
 
Nucleotide Sequence: 1437 bp     [Download]
>ref|NC_015379.1|:c2444446-2443010 hypothetical protein PSEBR_a1997 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
ATGAAAAGTAATGGACTGCTCAAATGGTTGATGATCCCGATGGCGCTACTGCTCGTGTTGGTTTTGGCAA
AACTGATGCCCGGCAAAAAAGTTTCGCCATCCGACCCGATCGATAGTGAAAGCCGACTCACTGTTGAAGA
GATGAAAGCACTTGGCCTTGAGGGTGATACGCCAAGCGATACGGTCGCAACTTTGGTGGCGCAGGTCAGG
CAATTGCGAGGCGAACTGAAAAACTCGCTTGGCGACAATGAGCGGCGTGATCCTGGGACGGATCAACTGC
GTCAGCTTGAAGATACCGTAGAGCAACGCATTCAGCTGGCCCTGGAAAAAGAGCGGCAGCGCATACAGGA
AGAGCAGAATGCCTTAGCGAACGACACTTCTGACATCCAAGGGCTGCTGCAAAGTCTTCAATGGCAACTG
GATAACCTGAGGCAAGAAGACAGTCACTTGGATGTGCCGGTGGGCATGGGCCAACTGGAGGGTGCCGGAC
AGGGTTTCAGGGATAGCATCCACTGGGTTGAGCCAGACGATGCAAAACCAAAAGACGTAGCTGGATCTTC
AGCAGAACCCATCTTCAGCTTCCCGACAAGTTTTGGTCCTGCGCAAAAAACACTAGGCGCCATTGCTGAC
TCGGCAACAAGCAGCGCTTCAGGGAGCTTCGACGTCCCGTCCGCTAAACCCACCTATACCGTTCCGCCAA
ATGCCACGCTAATGGGATCAGTCGCGATGACAGCTCTTATCGGCCGAGTACCCATCGACGGAACGGTCAA
CGATCCCTTCCCTTTTAAGGTCCTGATCGGAGCTGACAACCTGACAGCCAACGGGATTGATCTGCCTGAG
GTAGCCGGTGCAGTAATCAGCGGCACCGCGTCAGGCGATTGGACGTTGTCTTGCGTACGAGGCCAAATAC
GCTCTATCACGTTCGTCTTCCAGGACGGCACTATCCGAACCCTACCCGCAGACAATCAAAGCGATTCGCG
CGGTAGCTCACAGCACTCGTCCAATAGCGGTGCGACTCAAGAAGGCCTGGGCTGGATTAGCGATCGCCAT
GGCATCCCCTGTGTTGCCGGCACGCGTCGCAGCAACGCCCAGCAGTACCTGGGCTCCCAAGCATTGATCA
CCGCCGCAGGGGTCGGTGCGGCCTCGTTGATCAAGTCCGACGGCAATACCGTCTACGCCGGAAATAGTGG
TGGTTCATTGGGCACCGTTGGCATCTCTGGAAGCGAAGCCATGAATCGACTACTGGCCAGCGGCGTGCAA
GACATCTCGCAGTGGGTCAACAAGCTCTACGGCCAAGCCTTTGCGGCGGTTTACGTCGAGCCTGGCGCCC
AAGTTGCCGTGCACATCGAACAGCCCCTTACCCTCGACTACGACGCCAAGGGGCGCAAAGTCGATCACAC
CCTTGGAGGTCGCCATGTCGTCTCGGATTTGGACTGA