SecReT4
Protein ID: 330808771
T4SS name [ID]Tfc [724]
Gene symbol-
Locus tagPSEBR_cmegm44
StrainPseudomonas brassicacearum subsp. brassicacearum NFM421
Repliconchromosome [GenBank: NC_015379] [Browse all T4SS(s) in this replicon]
Location [Strand]2444436..2445323 [-]
Producthypothetical protein
Component typeTfc13
UniProt IDF2KF03
KEGG IDpba:PSEBR_cmegm44
PDB IDNA
Domain hit(s) vs Pfam DUF3438 [PF11920], Evalue: 6.7e-112, Aligned region: 12..276
Protein Sequence: 295 a.a.     [Download]
>gi|330808771|ref|YP_004353233.1| hypothetical protein PSEBR_cmegm44 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
MKSLFSYVSLGIALNLFAAAGQAVEIMRWERLPLAVPLLVGQERVVFVDRNVRVGLPSAVGGRLRVQSAG
GAVYLRAEEPIEPTRLQLQDAVTGELILLDITAELAEERQSQLEPIRIVEQATQHHRLKANNPAEGDLHN
ERSQHTPLPVTLTRYAAQNLYAPLRTVEPLPGVRRVNLPPDLSLDLLLPSLPVGARALAAWRLDEYWVTA
IRMTNQTEQIIDLDPRVLLGDFATATFQHNHLGPRGTSLDTTVLYLTTRGHSLAQSLLPTISPVDATLNL
PHTDLDTTVEVGNEK
 
Nucleotide Sequence: 888 bp     [Download]
>ref|NC_015379.1|:c2445323-2444436 hypothetical protein PSEBR_cmegm44 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
ATGAAATCGTTGTTCTCATATGTCTCCTTAGGGATCGCACTCAACCTTTTTGCCGCAGCAGGCCAAGCCG
TGGAAATCATGCGTTGGGAGCGCCTGCCATTGGCTGTTCCCTTACTGGTAGGTCAGGAACGCGTGGTATT
TGTCGATCGAAACGTGCGCGTAGGCTTACCAAGTGCAGTAGGCGGTAGGCTGCGCGTACAAAGCGCTGGA
GGAGCCGTGTATTTACGGGCAGAAGAGCCAATTGAGCCTACCCGTCTACAACTACAGGATGCCGTCACAG
GCGAACTAATCCTCCTGGATATCACCGCCGAGCTCGCAGAGGAAAGGCAGTCACAGTTGGAACCCATCAG
GATCGTTGAACAAGCCACCCAGCATCACCGCTTGAAGGCCAATAACCCAGCGGAGGGTGATTTACACAAT
GAACGATCACAGCACACACCTCTACCGGTGACTCTGACACGCTATGCCGCCCAAAACTTGTACGCACCGC
TACGAACTGTAGAACCTTTACCTGGCGTGCGACGCGTCAATCTACCACCCGACCTATCACTTGACCTGTT
GCTGCCGAGCTTACCTGTTGGGGCAAGGGCTTTGGCGGCGTGGCGGCTTGATGAGTATTGGGTGACGGCC
ATTCGCATGACGAATCAAACCGAGCAAATCATCGATCTAGATCCACGTGTGTTGCTAGGGGATTTCGCGA
CAGCCACCTTCCAACACAACCACTTGGGTCCTAGGGGTACATCGCTCGACACGACGGTCCTTTACCTGAC
CACTCGCGGACACAGTCTTGCGCAATCCCTGCTACCGACCATCAGCCCTGTCGACGCAACTCTCAACCTA
CCCCATACCGACCTGGATACAACCGTGGAGGTAGGCAATGAAAAGTAA