SecReT4
Protein ID: 330808772
T4SS name [ID]Tfc [724]
Gene symbol-
Locus tagPSEBR_m643
StrainPseudomonas brassicacearum subsp. brassicacearum NFM421
Repliconchromosome [GenBank: NC_015379] [Browse all T4SS(s) in this replicon]
Location [Strand]2445320..2446003 [-]
Producthypothetical protein
Component typeTfc12
UniProt IDF2KF04
KEGG IDpba:PSEBR_m643
PDB IDNA
Domain hit(s) vs Pfam DUF2895 [PF11444], Evalue: 4.3e-89, Aligned region: 6..206
Protein Sequence: 227 a.a.     [Download]
>gi|330808772|ref|YP_004353234.1| hypothetical protein PSEBR_m643 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
MSRFKNEVLHLQSHVKTLRLCSGALFILVLGLGVGWWTAPRDMTIHVPPDLRSGSTRKWWEVPPESVYAF
TFYIFQQLNRWPTDGEEDYNRNLQSLTAYLTPKCRSFFQHDYDQRRRSGELRKRVRGLYEIPGRGFGDDP
ETRVKVVSDRDWIVTLDVNADEYYGAEQIKRALVRYPIKVVRLDVDPELNPFGLALDCYDGAPQRIVMPA
PSSPGSRDLDQPLGDAS
 
Nucleotide Sequence: 684 bp     [Download]
>ref|NC_015379.1|:c2446003-2445320 hypothetical protein PSEBR_m643 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
ATGAGTCGGTTCAAAAACGAGGTACTTCATCTTCAGTCTCATGTGAAAACGCTGCGTTTATGCTCGGGAG
CCCTTTTCATTTTGGTCCTGGGCCTGGGTGTGGGCTGGTGGACAGCTCCACGGGATATGACGATACATGT
ACCGCCCGATTTGCGCTCTGGCAGTACTCGCAAATGGTGGGAGGTGCCCCCCGAGTCTGTGTACGCCTTC
ACCTTCTACATATTCCAACAACTCAATCGCTGGCCCACCGATGGCGAGGAGGACTACAACCGAAACTTGC
AGTCACTAACGGCATATCTCACGCCCAAATGCCGCTCTTTTTTCCAACATGACTACGACCAGCGGCGCCG
TTCAGGCGAACTGAGAAAAAGAGTACGGGGCCTATACGAAATTCCCGGGCGTGGTTTTGGGGATGATCCA
GAAACTCGCGTGAAGGTGGTCTCGGATCGGGATTGGATCGTCACCCTGGACGTCAATGCTGACGAGTACT
ACGGCGCAGAGCAGATTAAACGTGCGCTCGTTCGCTATCCCATCAAGGTCGTGCGTTTGGACGTCGATCC
AGAACTCAACCCATTCGGCCTTGCATTGGACTGTTACGACGGTGCTCCTCAACGCATTGTTATGCCCGCC
CCCTCCTCTCCTGGCTCACGAGATTTGGATCAACCTCTGGGAGATGCCTCATGA