SecReT4
Protein ID: 330808779
T4SS name [ID]Tfc [724]
Gene symbol-
Locus tagPSEBR_a2001
StrainPseudomonas brassicacearum subsp. brassicacearum NFM421
Repliconchromosome [GenBank: NC_015379] [Browse all T4SS(s) in this replicon]
Location [Strand]2448780..2450909 [-]
Producthypothetical protein
Component typeTfc6
UniProt IDF2KF11
KEGG IDpba:PSEBR_a2001
PDB IDNA
Domain hit(s) vs Pfam TraG-D_C [PF12696], Evalue: 5.2e-16, Aligned region: 501..631
AAA_10 [PF12846], Evalue: 1.2e-11, Aligned region: 190..579
TrwB_AAD_bind [PF10412], Evalue: 1.7e-11, Aligned region: 181..228
TrwB_AAD_bind [PF10412], Evalue: 1.7e-11, Aligned region: 498..635
Protein Sequence: 709 a.a.     [Download]
>gi|330808779|ref|YP_004353241.1| hypothetical protein PSEBR_a2001 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
MAQSHAVETLLRPAVELYSVAACGSAAALCLTAPWSLALSPSLGMGAAFTFAILGLVRLKQACIVLRYRR
QMRRLPRYVMTSREIPVSHQRLFVGKGFRWDQRHTHRLMQTYRPEFRKYVEPSVSYQMARRLEARLEFAS
PLLMHLPRLTSLDHPLNPVRPLPPVGGLPRLHAVEPQEVDVTLPLAERVGHTLVLGTTRVGKTRLAELFI
TQDIRRGEVCIVFDPKGDAELLKRMYVEAKRADREGEFYVFHLGQPSISARYNAIGRFGRITEVASRIAG
QLSGEGNSAAFREFAWRFVNIIARALVELGQRPDYLLIQRHVINIDALFIEYSAYFFAEHEPKAWEVIVQ
IEAKLNEKNIPRHMMGREKRVVAIEQYLSQARLYDPVLDGLRSAVRYDRTYFDKIVASLLPLLEKLTTGD
IAQLLAPDYVDLEDPRPIFDWMQAIRKRAVVYVGLDALSDSEVASAVGNSMFSDLVSVAGHIYKFGIDDG
LPGASADKKIPINVHADEFNELMGDEFIPMINKGGGAGIQVTAYTQTLSDIEARIGNRAKAGQVIGNFNN
LFMLRVRETATAELLTKQLPMVEVYATSVMSAATDSSDPHGSTAFTSNTQDRVTTTSVPMIEPAHVVALP
KGQAFGLIEGGQLWKIRMPLPAPDPDEAMPKDLQTMAGYMRKRYVAANDWWSSTAAQNPESSLPEDLLED
SSHPELSDV
 
Nucleotide Sequence: 2130 bp     [Download]
>ref|NC_015379.1|:c2450909-2448780 hypothetical protein PSEBR_a2001 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
TTGGCTCAGTCACATGCTGTTGAAACGTTACTAAGGCCAGCCGTTGAACTGTACAGCGTTGCTGCATGTG
GTTCGGCGGCTGCTTTGTGTCTCACAGCACCTTGGTCACTGGCACTTTCCCCGTCTCTTGGGATGGGGGC
AGCATTTACCTTTGCCATCCTGGGTTTGGTTCGTCTGAAGCAGGCTTGCATTGTGCTGCGCTATCGTAGG
CAAATGAGACGTCTGCCGCGCTATGTGATGACCAGTCGCGAGATACCGGTCAGTCATCAACGCTTGTTTG
TCGGCAAAGGGTTTCGCTGGGATCAACGCCATACCCATCGGCTGATGCAGACCTACCGACCGGAATTTCG
AAAGTATGTTGAGCCATCAGTGTCGTATCAGATGGCACGTCGGTTGGAGGCGCGGCTGGAATTTGCATCT
CCCCTGTTGATGCATCTGCCTCGACTCACAAGCTTGGACCATCCATTAAATCCGGTCAGGCCATTACCTC
CGGTTGGCGGGCTTCCCAGGTTGCATGCTGTCGAACCCCAAGAAGTCGATGTCACCCTTCCGTTGGCTGA
ACGAGTCGGCCATACACTGGTGCTAGGCACGACGCGGGTCGGCAAGACTCGGCTGGCGGAGCTGTTTATC
ACCCAGGACATCCGCCGCGGCGAGGTCTGTATCGTATTTGATCCGAAGGGCGATGCTGAGCTGCTCAAGC
GGATGTACGTTGAAGCCAAGCGTGCCGATCGTGAAGGCGAATTCTATGTATTCCACCTGGGACAGCCCTC
CATCTCTGCCCGCTACAACGCTATCGGTCGTTTCGGACGAATCACAGAGGTAGCGTCTCGTATCGCCGGG
CAATTATCAGGTGAAGGCAACTCCGCGGCCTTTAGGGAGTTCGCCTGGCGCTTCGTCAACATCATTGCCA
GGGCGTTGGTCGAATTGGGGCAACGACCGGACTACCTCCTAATTCAACGTCATGTCATCAATATCGATGC
CCTGTTCATCGAGTATTCCGCTTACTTCTTTGCTGAGCATGAGCCAAAAGCTTGGGAGGTCATCGTCCAA
ATCGAGGCCAAGCTCAACGAGAAGAACATTCCAAGGCACATGATGGGGCGAGAGAAACGCGTCGTCGCGA
TCGAGCAGTACCTGTCCCAGGCGCGGCTTTATGATCCTGTCCTTGATGGTCTTCGTTCCGCCGTACGGTA
TGACCGCACCTACTTCGACAAAATCGTCGCATCGCTTCTCCCGCTCTTGGAGAAGCTCACCACGGGTGAC
ATCGCCCAACTATTGGCACCTGACTACGTGGATCTGGAGGATCCACGGCCGATCTTTGACTGGATGCAGG
CCATTCGTAAACGAGCGGTGGTCTACGTTGGGCTTGACGCCTTGTCCGACTCGGAAGTCGCTTCTGCCGT
GGGTAATTCAATGTTTTCTGACCTGGTATCCGTCGCAGGTCATATCTACAAATTTGGTATTGATGATGGT
CTGCCCGGGGCATCAGCAGACAAAAAAATCCCAATCAATGTCCATGCCGATGAATTCAACGAACTGATGG
GGGACGAGTTCATCCCGATGATCAACAAAGGCGGTGGCGCTGGCATCCAGGTAACGGCCTACACCCAGAC
CCTCAGCGATATAGAGGCGCGCATTGGCAATCGCGCCAAGGCCGGCCAAGTGATCGGCAACTTCAACAAC
CTTTTCATGCTTCGGGTTCGGGAAACTGCGACAGCCGAACTGCTCACCAAGCAATTGCCTATGGTCGAGG
TTTATGCGACCTCGGTGATGAGCGCGGCCACTGACAGCTCAGATCCGCACGGCTCCACTGCCTTCACATC
AAATACTCAAGATCGGGTCACGACGACCAGCGTTCCGATGATTGAACCTGCGCACGTTGTGGCTCTGCCA
AAGGGCCAAGCATTTGGATTGATCGAGGGTGGGCAGCTCTGGAAGATTCGCATGCCTTTACCGGCGCCGG
ATCCTGATGAGGCCATGCCCAAAGACCTGCAAACGATGGCTGGGTACATGCGCAAACGCTACGTGGCAGC
TAATGACTGGTGGAGTTCGACAGCAGCTCAAAACCCAGAGTCCTCCTTACCTGAGGATCTTCTCGAGGAT
AGCTCTCACCCAGAGCTCAGCGACGTATGA