SecReT4
Protein ID: 330808780
T4SS name [ID]Tfc [724]
Gene symbol-
Locus tagPSEBR_a2002
StrainPseudomonas brassicacearum subsp. brassicacearum NFM421
Repliconchromosome [GenBank: NC_015379] [Browse all T4SS(s) in this replicon]
Location [Strand]2450912..2451340 [-]
Producthypothetical protein
Component typeTfc5
UniProt IDF2KF12
KEGG IDpba:PSEBR_a2002
PDB IDNA
Domain hit(s) vs Pfam DUF2859 [PF11072], Evalue: 2.2e-43, Aligned region: 26..141
Protein Sequence: 142 a.a.     [Download]
>gi|330808780|ref|YP_004353242.1| hypothetical protein PSEBR_a2002 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
MRLSYAWVFAILALNCNGSFAEDPKLQYAEARYSEDDMLPVRTTALSPGSVQRRTMNAAGLPAFFLIGDD
DRSRIWLKQRLPQLTKLKATGLVVNVESKSALVNLRQMAPGLTLSPVSADDLANRLDLRHYPVLITARSI
EQ
 
Nucleotide Sequence: 429 bp     [Download]
>ref|NC_015379.1|:c2451340-2450912 hypothetical protein PSEBR_a2002 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
ATGAGATTAAGCTATGCATGGGTATTCGCCATCCTGGCATTGAACTGCAACGGTAGCTTTGCTGAGGATC
CGAAGCTCCAGTATGCAGAAGCACGCTACAGCGAAGATGACATGTTGCCGGTTCGTACAACAGCCTTGTC
ACCAGGCTCCGTCCAGCGCCGCACAATGAATGCAGCGGGCCTACCGGCGTTTTTCTTGATCGGCGACGAC
GATCGTTCACGCATATGGCTGAAGCAGCGCCTGCCTCAGCTTACAAAACTTAAGGCAACGGGATTAGTCG
TCAACGTCGAGTCCAAGTCGGCACTAGTCAATCTACGCCAGATGGCTCCAGGTCTGACGCTCTCACCGGT
ATCAGCCGATGACTTGGCCAACCGCTTGGATCTTAGACATTACCCAGTGCTGATCACAGCTCGTAGTATC
GAGCAGTAG