SecReT4
Protein ID: 330808781
T4SS name [ID]Tfc [724]
Gene symbol-
Locus tagPSEBR_a2003
StrainPseudomonas brassicacearum subsp. brassicacearum NFM421
Repliconchromosome [GenBank: NC_015379] [Browse all T4SS(s) in this replicon]
Location [Strand]2451499..2452218 [-]
Producthypothetical protein
Component typeTfc3
UniProt IDF2KF13
KEGG IDpba:PSEBR_a2003
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 239 a.a.     [Download]
>gi|330808781|ref|YP_004353243.1| hypothetical protein PSEBR_a2003 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
MPRLQLMPPLLLLLVSSIDAHEPSAKTSAEVTSSLRPDMVLPMAEAALAQQWGLREEEFDRFRTLMQGPL
GTYSPNLDPLSALGIEARTDAERRRYALLQVEAEAARVEKLLAYQRAYDQAWKDRFPAMALVNLPPMSSP
ATISATMKKAVFVRYDCPECERLVKQLQASGAAFDLYVVDSEQDDKRIRHWVQKVGITPSKIRDSSITIN
HDNGRWASISAGDDLPAVMHKVDGKWLRQ
 
Nucleotide Sequence: 720 bp     [Download]
>ref|NC_015379.1|:c2452218-2451499 hypothetical protein PSEBR_a2003 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
ATGCCCCGCCTGCAGTTAATGCCCCCACTACTCCTGTTGCTGGTTTCCAGCATTGACGCCCACGAGCCAA
GTGCCAAGACCTCCGCGGAAGTCACTAGTTCGCTGCGCCCAGACATGGTTTTGCCCATGGCTGAAGCAGC
GCTAGCTCAACAATGGGGGTTGCGAGAAGAAGAGTTTGATCGCTTTAGAACGCTGATGCAGGGCCCACTA
GGGACTTACTCTCCCAATCTTGATCCCTTGAGTGCATTGGGGATTGAGGCGCGCACCGATGCCGAACGGC
GCCGTTATGCACTACTTCAAGTGGAGGCTGAAGCAGCACGTGTCGAGAAGCTACTGGCCTATCAGCGTGC
CTATGACCAAGCCTGGAAAGATCGTTTCCCCGCAATGGCGCTGGTCAACTTACCGCCGATGAGCAGCCCT
GCGACGATTAGCGCAACGATGAAAAAAGCGGTTTTCGTCCGCTACGACTGCCCAGAGTGCGAGCGACTGG
TCAAACAGCTACAGGCCTCTGGCGCAGCGTTCGATCTCTATGTTGTCGACAGCGAGCAAGATGACAAACG
CATCCGTCATTGGGTTCAAAAAGTCGGCATCACACCCAGCAAAATACGTGACAGCTCCATCACCATTAAT
CACGACAACGGTCGCTGGGCATCAATCAGCGCTGGAGATGATTTGCCGGCAGTAATGCATAAGGTAGATG
GCAAATGGTTGCGTCAATAA