SecReT4
Protein ID: 330808783
T4SS name [ID]Tfc [724]
Gene symbol-
Locus tagPSEBR_cmegl43
StrainPseudomonas brassicacearum subsp. brassicacearum NFM421
Repliconchromosome [GenBank: NC_015379] [Browse all T4SS(s) in this replicon]
Location [Strand]2452868..2453395 [-]
Producthypothetical protein
Component typeTfc2
UniProt IDF2KF15
KEGG IDpba:PSEBR_cmegl43
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 175 a.a.     [Download]
>gi|330808783|ref|YP_004353245.1| hypothetical protein PSEBR_cmegl43 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
MPSLKTRLTLLALLNSLTIVGCQNTGAPPAQTLHEEAVSQPSNHYIPVQRYGRYTLVELAPEAAQQNLLL
QVIDINLPSAWSISVGDALNYILLRSGYRLCDSTSENAALFTLPLPAAHLKIGPMVLRDALQMLAGPAWS
LQTHERLRQICFIPAVESASAGTSTRTFAMPEATR
 
Nucleotide Sequence: 528 bp     [Download]
>ref|NC_015379.1|:c2453395-2452868 hypothetical protein PSEBR_cmegl43 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
ATGCCATCGCTCAAAACTCGTCTCACCCTCCTCGCTCTACTCAACAGCCTGACAATTGTGGGCTGCCAAA
ATACTGGAGCACCTCCCGCCCAAACATTGCATGAAGAAGCTGTTTCTCAACCTTCAAATCATTACATCCC
CGTTCAACGATACGGGCGCTACACGTTGGTCGAGTTGGCACCTGAAGCGGCACAACAGAACCTTCTGCTA
CAAGTGATCGATATCAACCTTCCATCCGCCTGGTCCATCTCTGTCGGCGACGCCTTGAATTACATCCTGC
TGCGATCAGGTTATCGGCTTTGCGACAGCACTTCTGAAAATGCAGCCCTATTCACGCTCCCGCTCCCGGC
TGCACATCTGAAAATCGGTCCCATGGTGCTGCGCGATGCATTGCAGATGCTTGCCGGCCCTGCCTGGTCG
CTACAAACCCACGAACGCCTTCGCCAGATCTGTTTCATCCCAGCGGTTGAAAGCGCATCTGCCGGGACTT
CTACGAGAACTTTTGCAATGCCTGAGGCGACCCGATGA