SecReT4
Protein ID: 346643174
T4SS name [ID]Tfc [681]
Gene symbol-
Locus tagPFL_6233
StrainPseudomonas fluorescens Pf-5
Repliconchromosome [GenBank: NC_004129] [Browse all T4SS(s) in this replicon]
Location [Strand]5434806..5435243 [+]
Productconjugative transfer region lipoprotein
Component typeTfc15
UniProt IDF9XXE5
KEGG IDpfl:PFL_6233
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 145 a.a.     [Download]
>gi|346643174|ref|YP_004842369.1| unnamed protein product [Pseudomonas fluorescens Pf-5]
MSQPRSINALPLAVMAIALLAGCTTNKDKLLPHGEETMMDVWQEGAPGGASSSSSRQVLDARLQLRRPLD
EQQMTNQRATADDFARTAQNEIYSQFKRLPNPDLVMYVFPHLAGSDPVPVPGYTTVFPLYQRVQYAMPGE
RTEDY
 
Nucleotide Sequence: 438 bp     [Download]
>gi|70728250|ref|NC_004129.6|:5434806-5435243 Pseudomonas fluorescens Pf-5 chromosome, complete genome
ATGTCCCAGCCGCGCTCGATTAATGCTCTCCCACTTGCAGTCATGGCAATTGCCCTCCTTGCAGGTTGCA
CAACAAACAAAGACAAACTGCTCCCGCACGGAGAAGAAACCATGATGGATGTTTGGCAAGAGGGAGCCCC
AGGAGGGGCAAGCAGCTCAAGCAGCCGACAAGTGCTCGATGCACGGTTACAACTGAGACGTCCCCTCGAT
GAGCAGCAGATGACGAATCAGCGCGCCACAGCAGACGACTTTGCACGCACCGCACAGAACGAGATCTACA
GTCAATTTAAACGCCTGCCAAATCCTGACCTGGTCATGTACGTGTTCCCGCATCTGGCCGGATCTGACCC
AGTGCCTGTACCCGGATACACCACCGTTTTTCCGCTCTATCAGCGTGTGCAGTACGCAATGCCAGGCGAG
CGGACAGAGGACTATTGA