SecReT4
Protein ID: 348589251
T4SS name [ID]Tra_F [81]
Gene symboltraE
Locus tagPHK17A_p062
StrainEscherichia coli plasmid pHK17a (NC_016039)
Repliconplasmid pHK17a [GenBank: NC_016039] [Browse all T4SS(s) in this replicon]
Location [Strand]35475..36041 [+]
Productprotein TraE
Component typeTraE_F
UniProt IDQ6SJ24
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 1.4e-69, Aligned region: 1..187
Protein Sequence: 188 a.a.     [Download]
>gi|348589251|ref|YP_004870054.1| protein TraE [Escherichia coli]
MEHGARLSTSRVMAIAFIFMSVLIVLSLSVNLIQGVNNYRLQNEQRTAVTPMGFNVPFAVSQNSADASYL
QQMALSFIALRLNVSPEIVDASHQALLQYIRPGAQNQMKVILAEEAKLIKKDNVNSAFFQTSVRVWPQYG
RVEIRGIRKTWIGNSEPFTDIKHYILILKRENGVTWLDNFGETDDEKK
 
Nucleotide Sequence: 567 bp     [Download]
>gi|348589192|ref|NC_016039.1|:35475-36041 Escherichia coli plasmid pHK17a, complete sequence
ATGGAACACGGTGCCCGTTTAAGTACCAGTCGTGTAATGGCCATCGCCTTTATATTTATGTCAGTGCTTA
TTGTTCTCAGCCTCTCTGTTAACCTCATTCAGGGGGTGAATAACTACCGTCTTCAGAATGAGCAACGCAC
TGCCGTGACCCCAATGGGATTTAATGTGCCCTTTGCCGTGTCACAGAACAGTGCCGATGCCTCTTATTTG
CAGCAGATGGCGCTGTCATTTATTGCCCTCCGTCTGAATGTCTCACCGGAAATCGTCGATGCTTCACATC
AGGCGCTTCTGCAATATATCCGCCCGGGTGCACAGAACCAGATGAAAGTTATTCTGGCTGAAGAAGCGAA
ACTCATTAAAAAAGATAACGTGAATTCTGCTTTTTTCCAGACCAGTGTCCGTGTCTGGCCTCAGTATGGT
CGTGTGGAAATCCGTGGAATTCGGAAAACATGGATTGGTAACTCCGAACCTTTTACTGATATCAAACATT
ACATCCTTATTCTGAAGCGGGAAAACGGGGTGACCTGGCTGGATAATTTCGGGGAAACAGACGATGAGAA
AAAATAA