SecReT4
Protein ID: 378976089
T4SS name [ID]Tra_F [811]
Gene symbol-
Locus tagKPHS_p201040
StrainKlebsiella pneumoniae subsp. pneumoniae HS11286
Repliconplasmid pKPHS2 [GenBank: NC_016846] [Browse all T4SS(s) in this replicon]
Location [Strand]77914..78084 [-]
Productconjugal transfer protein TraY
Component typeTraY_F
UniProt IDG8XCG9
KEGG IDkpm:KPHS_p201040
PDB IDNA
Domain hit(s) vs Pfam TraY [PF05509], Evalue: 1.3e-23, Aligned region: 2..47
Protein Sequence: 56 a.a.     [Download]
>gi|378976089|ref|YP_005229720.1| conjugal transfer protein TraY [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MLLKLDEETNRRLIKAKDRSRRSKTAEAYLRLKDHLERFPDFYNSELAVPGGEKEE
 
Nucleotide Sequence: 171 bp     [Download]
>gi|378975985|ref|NC_016846.1|:c78084-77914 Klebsiella pneumoniae subsp. pneumoniae HS11286 plasmid pKPHS2, complete sequence
GTGCTTTTAAAATTAGATGAAGAAACTAATCGTCGACTCATCAAAGCAAAAGACAGAAGCAGAAGAAGTA
AAACAGCTGAAGCTTATTTGAGACTGAAAGATCATCTAGAACGTTTTCCGGACTTTTATAACTCGGAACT
AGCCGTACCAGGAGGTGAAAAGGAAGAGTGA