SecReT4
Protein ID: 38638143
T4SS name [ID]Tra_I [183]
Gene symboltraR
Locus tagpEL60p54
StrainErwinia amylovora plasmid pEL60 (NC_005246)
Repliconplasmid pEL60 [GenBank: NC_005246] [Browse all T4SS(s) in this replicon]
Location [Strand]42834..43223 [+]
Productconjugative transfer protein
Component typeTraR_I
UniProt IDQ6TFU2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 129 a.a.     [Download]
>gi|38638143|ref|NP_943253.1| conjugative transfer protein [Erwinia amylovora]
MKIVKFIKDKALSASIAAYQLRGTVAKSLVVLPLALLSKEAAAETTVWEKINTFTEGMASTQPGLITAGK
VVGVVCFIVGLVALWLKNKRGKDISGGFIFWSMVVGACLVGLTAWISSVGSTVGVDATL
 
Nucleotide Sequence: 390 bp     [Download]
>gi|38638089|ref|NC_005246.1|:42834-43223 Erwinia amylovora LebB66 plasmid pEL60, complete sequence
ATGAAAATTGTTAAATTTATCAAAGACAAGGCGTTATCTGCATCCATCGCAGCGTATCAGCTGCGCGGAA
CGGTAGCAAAATCGTTAGTGGTATTGCCCCTGGCATTACTGAGCAAAGAGGCTGCAGCTGAAACGACTGT
CTGGGAAAAGATCAATACCTTCACAGAAGGTATGGCCAGTACCCAGCCTGGTCTGATTACCGCTGGTAAA
GTGGTTGGTGTTGTGTGCTTCATCGTAGGTCTTGTAGCTCTGTGGCTCAAAAACAAACGCGGGAAAGATA
TCAGTGGCGGCTTCATCTTCTGGTCAATGGTTGTTGGAGCCTGTCTGGTCGGCCTGACCGCATGGATCTC
TTCTGTTGGTTCAACCGTTGGCGTTGACGCAACCCTGTAA