SecReT4
Protein ID: 47104026
T4SS name [ID]Tra_F [542]
Gene symbol-
Locus tagPBPRC0001
StrainPhotobacterium profundum SS9
Repliconplasmid pPBPR1 [GenBank: NC_005871] [Browse all T4SS(s) in this replicon]
Location [Strand]317..709 [+]
Productputative sex pilus assembly and synthesis protein (TraY)
Component typeTraY_F
UniProt IDQ6LW96
KEGG IDppr:PBPRC0001
PDB IDNA
Domain hit(s) vs Pfam TraY [PF05509], Evalue: 1.1e-24, Aligned region: 20..67
TraY [PF05509], Evalue: 1.1e-24, Aligned region: 101..123
Protein Sequence: 130 a.a.     [Download]
>gi|47104026|ref|YP_015455.1| putative sex pilus assembly and synthesis protein (TraY) [Photobacterium profundum SS9]
MLNRTYMQKSKSDTYPTSHVTCFLSSFANKLLEESIGRSKRSKKKEAEIRLADHLDRYTLIPKSKCQYDS
ENIEYPSSHVTCFLAPTENELLDKTIVGLNPSKKQEAAKRLTEHLIEFISISELGNATKR
 
Nucleotide Sequence: 393 bp     [Download]
>gi|47104025|ref|NC_005871.1|:317-709 Photobacterium profundum SS9 plasmid pPBPR1, complete sequence
TTGTTGAATAGAACATATATGCAAAAATCAAAATCTGATACCTATCCGACATCACATGTGACTTGTTTTT
TATCTTCTTTCGCAAATAAATTACTTGAAGAATCAATAGGACGCTCAAAGCGTTCAAAAAAAAAAGAAGC
TGAAATCAGACTGGCAGACCATTTAGACAGATACACATTAATACCAAAATCTAAGTGCCAGTACGATAGT
GAAAATATTGAATATCCATCATCACATGTGACTTGTTTTTTAGCACCAACAGAAAACGAATTACTAGATA
AAACAATTGTCGGTTTAAATCCCTCAAAAAAACAAGAGGCAGCAAAAAGACTAACCGAACACTTAATTGA
ATTTATATCAATTTCAGAATTGGGTAACGCGACAAAACGTTAA