SecReT4
Protein ID: 47104028
T4SS name [ID]Tra_F [542]
Gene symbol-
Locus tagPBPRC0003
StrainPhotobacterium profundum SS9
Repliconplasmid pPBPR1 [GenBank: NC_005871] [Browse all T4SS(s) in this replicon]
Location [Strand]1503..1775 [+]
Producthypothetical protein
Component typeTraA_F
UniProt IDQ6LW94
KEGG IDppr:PBPRC0003
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 90 a.a.     [Download]
>gi|47104028|ref|YP_015457.1| hypothetical protein PBPRC0003 [Photobacterium profundum SS9]
MSTKLGVLIIATGVALAISQPALAADIFAGSKTVIKENADGDSGLYMGMTVAGLGSAALGGFLTKNWGGA
IGGFVTGMIFANTAMAIVGL
 
Nucleotide Sequence: 273 bp     [Download]
>gi|47104025|ref|NC_005871.1|:1503-1775 Photobacterium profundum SS9 plasmid pPBPR1, complete sequence
ATGTCAACGAAACTAGGTGTACTCATCATTGCTACCGGGGTAGCCCTGGCCATCAGCCAACCCGCCCTCG
CAGCCGATATCTTTGCTGGTTCAAAAACGGTCATCAAAGAAAATGCGGACGGTGATTCTGGGCTTTACAT
GGGCATGACCGTTGCCGGTCTGGGCTCCGCAGCCCTCGGGGGCTTCCTCACTAAAAACTGGGGCGGGGCC
ATCGGCGGGTTCGTCACGGGGATGATTTTCGCCAATACCGCAATGGCTATCGTAGGGCTCTAA