SecReT4
Protein ID: 47104030
T4SS name [ID]Tra_F [542]
Gene symbol-
Locus tagPBPRC0005
StrainPhotobacterium profundum SS9
Repliconplasmid pPBPR1 [GenBank: NC_005871] [Browse all T4SS(s) in this replicon]
Location [Strand]2651..3385 [+]
Producthypothetical protein
Component typeTraK_F
UniProt IDQ6LW92
KEGG IDppr:PBPRC0005
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 8.5e-72, Aligned region: 5..238
Protein Sequence: 244 a.a.     [Download]
>gi|47104030|ref|YP_015459.1| hypothetical protein PBPRC0005 [Photobacterium profundum SS9]
MNRWRWFAIIIAGCVSATAHAKNTPGTTYTFNDNDTVPVILSSVDINRLVVKNDKITGIDCPAGFCVVSG
TKTDTSGSARLKLNISVAFVAYVSTQKGRQFGMFITPQAIPGITSEFIGVQNTQHTPSVFEKKAPYTTQL
AEFTAQMIRWTNTGEMMGGFSLHPVDPKTVTNTLTARLAVIPDTIFVGNTFSGIRYKLKNNTTTTQTLTT
AQFYSRAARSAALSTDQLAPNDTAWLYIVTGGRW
 
Nucleotide Sequence: 735 bp     [Download]
>gi|47104025|ref|NC_005871.1|:2651-3385 Photobacterium profundum SS9 plasmid pPBPR1, complete sequence
ATGAACAGATGGCGATGGTTCGCGATCATCATAGCAGGGTGTGTGAGTGCCACGGCACACGCTAAAAACA
CCCCCGGCACCACTTATACCTTTAATGACAATGATACCGTCCCGGTTATCCTCTCCAGTGTTGATATCAA
CCGTTTGGTGGTGAAAAACGACAAGATCACCGGCATTGACTGCCCGGCAGGATTTTGTGTCGTCTCGGGC
ACCAAGACGGACACTTCGGGCTCTGCCCGACTCAAACTCAATATTTCCGTGGCGTTCGTCGCCTATGTCA
GCACTCAAAAAGGCCGACAATTTGGGATGTTCATTACCCCCCAAGCCATTCCGGGGATCACCTCTGAATT
TATCGGGGTGCAAAATACCCAGCACACCCCGTCGGTGTTTGAGAAAAAAGCCCCCTACACCACCCAACTG
GCAGAATTTACCGCGCAAATGATCCGCTGGACGAATACAGGGGAAATGATGGGCGGATTCAGCCTGCACC
CCGTGGATCCCAAGACGGTCACGAACACATTAACAGCGCGTTTGGCCGTGATCCCCGATACCATTTTCGT
CGGCAACACCTTCTCGGGCATTCGTTACAAACTGAAAAATAACACCACGACCACCCAAACATTGACCACT
GCCCAATTTTATTCCCGTGCAGCCCGCTCAGCCGCGTTATCAACCGACCAGCTGGCCCCGAACGACACGG
CCTGGTTGTACATTGTGACGGGAGGACGGTGGTGA