SecReT4
Protein ID: 47104032
T4SS name [ID]Tra_F [542]
Gene symbol-
Locus tagPBPRC0007
StrainPhotobacterium profundum SS9
Repliconplasmid pPBPR1 [GenBank: NC_005871] [Browse all T4SS(s) in this replicon]
Location [Strand]4860..5255 [+]
Producthypothetical protein
Component typeTraV_F
UniProt IDQ6LW90
KEGG IDppr:PBPRC0007
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 2.7e-16, Aligned region: 21..120
Protein Sequence: 131 a.a.     [Download]
>gi|47104032|ref|YP_015461.1| hypothetical protein PBPRC0007 [Photobacterium profundum SS9]
MRYFMLSLIALLLTGCSAGMKSNFSCEKIGGIEGCASMTDVRSAMDRGEFSPQGHVIKGEASHAYLTPTP
SFIPLPRRNREGAPLRTQEHVQKITIFPFTTPDGYYIDTTDVYIADDSQWTGRPVQAIRKD
 
Nucleotide Sequence: 396 bp     [Download]
>gi|47104025|ref|NC_005871.1|:4860-5255 Photobacterium profundum SS9 plasmid pPBPR1, complete sequence
ATGCGCTACTTCATGTTATCTCTGATCGCACTGCTGCTCACGGGCTGCTCTGCGGGGATGAAAAGCAATT
TTTCGTGTGAAAAAATAGGCGGGATTGAGGGCTGTGCATCCATGACCGATGTGCGCAGTGCCATGGACCG
AGGGGAATTTTCACCCCAAGGGCACGTTATCAAGGGGGAAGCCTCCCACGCCTATTTAACGCCGACGCCC
AGCTTTATTCCTCTGCCTCGCCGTAATCGAGAAGGTGCCCCCTTGCGCACACAAGAACACGTTCAAAAAA
TAACGATTTTTCCCTTTACCACCCCCGACGGGTATTACATCGATACCACCGATGTGTATATCGCCGATGA
TAGCCAGTGGACGGGCCGCCCTGTTCAAGCCATACGTAAGGATTAA