SecReT4
Protein ID: 47104038
T4SS name [ID]Tra_F [542]
Gene symbol-
Locus tagPBPRC0013
StrainPhotobacterium profundum SS9
Repliconplasmid pPBPR1 [GenBank: NC_005871] [Browse all T4SS(s) in this replicon]
Location [Strand]11009..12811 [+]
Productconjugal transfer mating pair stabilization protein TraN
Component typeTraN_F
UniProt IDQ6LW84
KEGG IDppr:PBPRC0013
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 1.5e-80, Aligned region: 321..556
Protein Sequence: 600 a.a.     [Download]
>gi|47104038|ref|YP_015467.1| conjugal transfer mating pair stabilization protein TraN [Photobacterium profundum SS9]
MTGRVCTVIALMFIASTAIASQEQRYTDNVNWAKQSATVTQGQSGFTAFSVNEYCKDTACQQQLSNPEQT
RYRNDATAMDSAKAAAIATDDNAQAVQANFNAGRPTIDPNDPAYSQAVGYMNDAYTISHGLVSQYHDCKK
GQTCEFSESIKHCAQPTHTPYTCDITPYVISKNEHTGSQRFPMSYPRSNAGNARVTSAGLQITLPAKVIV
TRIELPPFGVQSNTRSVSIDANGRPIKNATASPYWSDPWDMCGPIGSFCWSEVGAQTMNVSIDTSTLNLT
IRAADGRTGIHLMDKGTITVHWKTRTLNIGWKNSCGPTLPACSKTQEVCVEGGGSRWLHGVYQYLPCWKK
RQTYHCTYPDTCAALSTCVEQSRQCSKNTQGVCVQEKVTKKCTVQTCVDTNLICGEQSFCLDGECYSPTR
EQNTEFNQAASSLAALADAAKGLGDPPLLFTGKAMTCSKKPVGLSDCCKDSGWGSDVGLAQCNDEEKALM
QAKEKKLTISLGQYCAEKVLGVCIRKKKAYCTYDSKLARIVQEQGKPQLGMNFGSAKHPDCSAITPEQMQ
QMDFSNMDFSDFYSDLHNNMTLPDNNQIQQRIKETLGGKQ
 
Nucleotide Sequence: 1803 bp     [Download]
>gi|47104025|ref|NC_005871.1|:11009-12811 Photobacterium profundum SS9 plasmid pPBPR1, complete sequence
ATGACAGGCCGAGTGTGTACAGTCATCGCGTTGATGTTCATCGCATCAACGGCTATCGCCAGCCAAGAGC
AACGTTATACCGACAATGTTAACTGGGCTAAACAATCAGCCACCGTCACGCAGGGCCAATCAGGGTTCAC
CGCATTTTCAGTCAATGAATACTGTAAAGACACCGCCTGTCAGCAGCAACTCAGCAACCCGGAACAAACC
CGTTATCGCAATGATGCCACCGCCATGGACAGCGCGAAAGCCGCCGCCATCGCAACCGATGACAATGCCC
AAGCGGTGCAAGCCAATTTCAATGCAGGTCGCCCCACAATAGATCCCAATGATCCCGCTTATAGCCAAGC
GGTAGGATATATGAATGATGCCTATACCATCAGTCATGGGTTGGTGTCTCAATACCATGACTGTAAAAAA
GGGCAGACGTGTGAGTTCAGTGAATCTATTAAACATTGTGCGCAACCGACCCATACACCCTATACCTGTG
ATATTACCCCGTATGTTATCTCTAAAAATGAGCATACTGGCAGTCAACGCTTCCCCATGAGCTATCCAAG
AAGTAACGCAGGCAATGCAAGGGTGACATCCGCAGGATTGCAAATAACCCTTCCCGCAAAGGTCATTGTC
ACAAGAATAGAGCTCCCCCCTTTCGGGGTGCAATCAAATACGCGATCAGTATCTATTGATGCTAATGGAC
GGCCTATCAAGAATGCAACCGCATCGCCCTATTGGTCAGACCCATGGGATATGTGTGGCCCCATAGGCAG
CTTTTGCTGGTCTGAGGTAGGGGCACAAACGATGAATGTCTCTATCGATACGTCCACCCTTAATTTGACT
ATTCGCGCCGCCGATGGACGCACCGGTATTCACCTGATGGACAAGGGAACGATTACAGTACATTGGAAAA
CACGCACTCTGAATATTGGTTGGAAAAACAGTTGCGGCCCCACGCTGCCAGCGTGCAGTAAAACACAAGA
AGTCTGCGTGGAAGGCGGTGGTTCACGTTGGTTACACGGGGTCTATCAATACCTGCCTTGTTGGAAGAAA
CGCCAAACCTATCACTGCACCTACCCGGATACCTGTGCCGCGCTGTCTACCTGTGTCGAGCAATCTCGCC
AGTGCAGCAAAAACACCCAAGGCGTCTGTGTTCAAGAGAAAGTGACCAAAAAATGCACGGTTCAAACCTG
TGTCGATACCAACCTGATTTGCGGTGAACAATCCTTTTGTCTTGATGGGGAGTGTTATAGCCCAACCAGA
GAACAAAATACCGAATTTAATCAAGCCGCTTCCAGTCTCGCGGCCTTGGCCGATGCCGCCAAGGGATTAG
GGGATCCGCCGCTGCTGTTCACGGGTAAAGCCATGACCTGCAGCAAAAAGCCCGTCGGACTCAGTGATTG
CTGTAAAGACAGTGGCTGGGGCAGTGATGTTGGGCTTGCACAGTGCAATGATGAAGAAAAAGCCCTGATG
CAAGCCAAAGAAAAGAAACTCACCATCAGCCTCGGGCAATATTGCGCAGAAAAAGTGCTTGGGGTCTGTA
TTCGCAAGAAAAAAGCCTACTGCACCTATGACAGCAAGCTGGCCCGTATCGTCCAAGAGCAAGGCAAACC
CCAGTTAGGCATGAACTTTGGCAGTGCCAAACACCCTGATTGCTCGGCCATCACCCCAGAGCAAATGCAG
CAGATGGACTTTAGCAATATGGATTTTTCAGACTTTTACAGTGACCTGCACAACAACATGACCTTGCCGG
ACAACAACCAAATTCAGCAACGTATAAAAGAAACCCTCGGAGGCAAACAATGA