SecReT4
Protein ID: 47104044
T4SS name [ID]Tra_F [542]
Gene symbol-
Locus tagPBPRC0019
StrainPhotobacterium profundum SS9
Repliconplasmid pPBPR1 [GenBank: NC_005871] [Browse all T4SS(s) in this replicon]
Location [Strand]19147..21252 [+]
Productconjugative transfer protein TraD
Component typeTraD_F
UniProt IDQ6LW78
KEGG IDppr:PBPRC0019
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 1.9e-153, Aligned region: 180..565
TraD_N [PF12615], Evalue: 1.9e-22, Aligned region: 35..129
TraG-D_C [PF12696], Evalue: 1.8e-20, Aligned region: 423..545
T4SS-DNA_transf [PF02534], Evalue: 3.1e-16, Aligned region: 230..547
AAA_10 [PF12846], Evalue: 1.4e-14, Aligned region: 187..226
AAA_10 [PF12846], Evalue: 1.4e-14, Aligned region: 404..498
Protein Sequence: 701 a.a.     [Download]
>gi|47104044|ref|YP_015473.1| conjugative transfer protein TraD [Photobacterium profundum SS9]
MSNQRPKNSNYTRGGQITFHNITMFFQINAKLVRWMGYGILLLTALLCFSFIDQDTLKGTYYYWRYSMVG
KIKPDTHEVFTLWQGVTYKSTLGQQRLNPVFIDANRQFWLSLQLYLLASLISGLTVFSLAMRYFKKKGDE
QTDDHFIRGIQIATPPELARILKKANKQSDFALDGHKIFKQHFECQHLLFDGTTGSGKSVALRKFLRWIK
NRGDKAIIYDKGCTFVSKFYNPETDIILNAFDERCAYWDVWCDAKDATDFENMSAALIPMHGDGDPFWVQ
SARTIFTSTAYKMVNEPNRTTERLLELMLTSELESLSEYLKGTESASLVSDKIQKTAISIKSVLAAYIKS
LRFLEGLDRKDDQGNLVRPRFSIREWVKNKDENGFLFLSSNAQQHASLRPLLSMWLSIASTSILEQEEDH
DRRIWVVMDEAPSLHKLPELAETIAEVRKFGGCYVIGIQSFAQLKKIYGTNAALEMFDLLNTRFFFRSPS
NEMAKISSQDLGEQEMDISKENYSYGAHAMRDGISLGHQTITRPAVTPSEIMQLDDLQCWLRSPGDFPIT
KLDLKFDKMRSICPPFIRREYASSETMQSIEHMLTYCQISALNLLSSDDQNKLMSVHTGQFDDDTERNAE
EERMKATIDKAKAAKKKHVDKEKDTKNVKEKEAEKKVKALEQADGQAVTEQLFQEEQNINAMDHDMVDFG
E
 
Nucleotide Sequence: 2106 bp     [Download]
>gi|47104025|ref|NC_005871.1|:19147-21252 Photobacterium profundum SS9 plasmid pPBPR1, complete sequence
ATGAGTAATCAACGGCCTAAAAACAGCAACTACACCCGTGGCGGGCAAATCACTTTCCACAATATCACCA
TGTTCTTTCAAATTAATGCCAAGCTCGTTCGCTGGATGGGGTACGGCATCCTCCTGCTCACCGCCCTGCT
GTGTTTTTCTTTTATCGATCAAGACACCTTAAAAGGCACCTATTACTACTGGCGTTACAGCATGGTCGGC
AAAATAAAACCCGACACCCACGAGGTCTTCACCCTCTGGCAAGGCGTCACTTATAAAAGCACCCTGGGCC
AGCAACGGCTCAATCCTGTATTCATTGACGCCAATCGCCAATTTTGGCTGTCACTGCAACTGTACCTTCT
TGCCAGCCTGATAAGCGGCCTAACGGTCTTTAGCCTTGCCATGCGGTATTTCAAAAAGAAAGGGGATGAA
CAAACCGATGACCACTTTATTCGTGGAATACAAATAGCCACCCCGCCCGAGCTGGCTCGCATCCTCAAGA
AAGCCAATAAGCAGTCAGATTTCGCGCTCGATGGGCACAAAATCTTCAAGCAGCACTTTGAATGCCAGCA
CCTACTGTTCGACGGCACCACGGGATCAGGCAAATCGGTGGCACTGCGCAAGTTTCTGCGTTGGATTAAA
AATCGAGGCGATAAAGCCATCATTTACGACAAAGGCTGTACCTTCGTCAGTAAATTCTACAACCCGGAAA
CCGACATCATTCTCAATGCCTTTGATGAACGCTGCGCTTACTGGGATGTATGGTGCGATGCCAAGGATGC
CACTGACTTTGAAAACATGTCAGCCGCGCTCATTCCGATGCACGGCGATGGCGATCCGTTTTGGGTGCAA
TCTGCCCGCACGATTTTCACCTCCACCGCTTACAAGATGGTGAATGAGCCAAACCGGACGACTGAACGCC
TGCTCGAACTCATGTTGACCTCAGAGCTGGAGTCGCTCAGTGAATACCTTAAAGGCACGGAATCCGCGTC
ACTGGTCTCGGATAAAATCCAAAAAACAGCGATATCCATCAAATCGGTATTGGCCGCCTACATCAAATCC
CTGCGATTTTTAGAAGGACTCGATAGGAAAGATGATCAAGGCAACCTAGTACGCCCACGATTTTCTATTC
GGGAGTGGGTGAAAAACAAAGATGAAAACGGCTTCCTGTTCTTGTCCAGCAACGCCCAACAACACGCCTC
TTTACGCCCATTATTGTCCATGTGGTTATCCATCGCCTCCACCTCCATCTTGGAGCAAGAAGAAGATCAC
GACCGCCGGATTTGGGTGGTCATGGATGAAGCCCCGAGCTTGCATAAACTGCCGGAGCTGGCCGAGACCA
TTGCCGAAGTGCGTAAATTCGGTGGCTGCTATGTCATTGGTATTCAGTCCTTTGCCCAGCTTAAGAAAAT
CTACGGCACCAATGCAGCACTGGAAATGTTTGATTTGTTGAACACCCGCTTCTTTTTCCGCTCACCGTCC
AACGAAATGGCCAAGATTTCCTCGCAGGATTTGGGGGAGCAGGAAATGGACATTTCCAAAGAGAATTACA
GCTACGGTGCCCATGCCATGCGTGATGGTATTTCACTGGGACACCAGACCATCACCCGCCCTGCAGTGAC
CCCCTCAGAAATCATGCAATTGGATGATTTACAGTGTTGGCTTCGCAGTCCAGGGGATTTCCCTATCACC
AAACTTGATCTCAAATTCGACAAAATGCGCTCAATCTGCCCCCCCTTCATTCGACGTGAATATGCCTCGT
CAGAGACCATGCAGTCTATCGAACACATGCTGACCTATTGCCAAATCAGTGCGCTCAATCTGCTGTCATC
GGATGATCAAAACAAGTTGATGTCAGTACATACCGGACAATTTGACGATGACACTGAACGTAATGCAGAA
GAAGAACGCATGAAAGCCACCATTGACAAGGCCAAGGCTGCGAAGAAAAAGCACGTCGATAAAGAAAAAG
ACACCAAGAACGTCAAAGAGAAAGAAGCGGAAAAAAAAGTAAAAGCTCTGGAGCAAGCTGACGGTCAAGC
CGTTACCGAACAATTATTCCAGGAAGAGCAAAATATTAATGCCATGGATCATGACATGGTTGATTTCGGC
GAGTAA