SecReT4
Protein ID: 60115590
T4SS name [ID]Tra_I [184]
Gene symboltraV
Locus tagSC076
StrainSalmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67
Repliconplasmid pSC138 [GenBank: NC_006856] [Browse all T4SS(s) in this replicon]
Location [Strand]60237..60851 [+]
ProductTraV-like protein
Component typeTraV_I
UniProt IDQ5J405
KEGG IDsec:SC076
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 204 a.a.     [Download]
>gi|60115590|ref|YP_209381.1| TraV-like protein [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
MCTIHITPRCRRPARGQVFLKKLEVKGDSFSFTLPSRVFRLHPAPNPRVIYASDARTQGKVTGMRLLLPS
STDELITTAIWQVSVPDEAPFDVQHVIQWILPSPLASLMSDDTWLWPSVPGTPALSAGDWPVMDTDPSTL
RRVRRRSFSIIDNRNRKGYITRRYQCFPLAPLPEDRKYDSLPDLVLHPEQETIKCKEKHYSQPL
 
Nucleotide Sequence: 615 bp     [Download]
>gi|60115514|ref|NC_006856.1|:60237-60851 Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67 plasmid pSC138, complete sequence
ATGTGTACAATTCATATCACCCCACGCTGCCGGAGACCTGCCAGAGGGCAGGTATTTCTTAAAAAACTTG
AGGTAAAAGGTGACAGTTTCTCATTCACTCTGCCGTCACGTGTCTTCAGGTTACATCCGGCCCCCAATCC
CAGAGTGATATACGCCTCGGATGCCAGAACACAGGGAAAGGTCACAGGCATGCGGCTGTTGTTGCCGTCC
AGCACAGATGAGCTGATAACAACGGCAATATGGCAGGTTTCTGTCCCGGATGAAGCACCATTCGACGTTC
AGCATGTCATCCAGTGGATACTCCCTTCACCGCTGGCTTCGCTGATGTCCGATGATACCTGGTTATGGCC
ATCCGTTCCCGGAACGCCGGCACTGAGTGCCGGTGACTGGCCTGTTATGGATACTGACCCTTCCACCTTA
CGGCGCGTCAGACGTCGTTCTTTCAGCATCATCGATAACCGGAACAGGAAAGGTTATATCACCAGGCGAT
ATCAGTGTTTCCCACTGGCCCCACTACCTGAAGACAGAAAATACGACAGCCTTCCTGACCTTGTGCTCCA
TCCCGAGCAGGAGACAATAAAATGCAAAGAAAAACATTACTCGCAGCCCTTATAG