SecReT4
Protein ID: 66044701
T4SS name [ID]Tfc [682]
Gene symbol-
Locus tagPsyr_1454
StrainPseudomonas syringae pv. syringae B728a
Repliconchromosome [GenBank: NC_007005] [Browse all T4SS(s) in this replicon]
Location [Strand]1640953..1643112 [-]
Producthypothetical protein
Component typeTfc6
UniProt IDQ4ZWG8
KEGG IDpsb:Psyr_1454
PDB IDNA
Domain hit(s) vs Pfam TraG-D_C [PF12696], Evalue: 5.2e-16, Aligned region: 506..634
TrwB_AAD_bind [PF10412], Evalue: 5.2e-10, Aligned region: 508..644
AAA_10 [PF12846], Evalue: 8.2e-08, Aligned region: 191..583
Protein Sequence: 719 a.a.     [Download]
>gi|66044701|ref|YP_234542.1| unnamed protein product [Pseudomonas syringae pv. syringae B728a]
MAHDYAIESLLRPAVELYTVYVCAAGAFLCVFAPWAFALTPLFGIVTSAGFLALGLVRLKQAWQVLRYRR
NIRRLPHYTMTSKEVPVSNQRLFIGLGFRWQQRHTQRLMDTYLPKYASYVEATSLFRAARRFEERAEFAP
YPVRLLARATSWDVPINPVRPLPPVGGLPRLHGIEPYEENVSLPLGERVGHSIVLGTTRVGKTRLAELFI
TQDIRRKKHGKHEVVIVFDPKGDADLLKRMYLEAKRAGRLNEFYVFHLGWPDHSARYNAVGRFGRISEVA
TRIAGQLSGEGNSAAFREFAWRFVNIIARALVALGRRPDYLQIQQHVINIEGIFQEYASKYFDEYDPKAW
EAIVAIEGKLNEKNVPFNMKGRPFRVVAIDQYLSQTRVADPVMDGLRSAVRYDKTYFDKIVASLLPLLEK
LTTGRMAELISPDYQDVNDPRPIFDWMQVVRKKAVVYIGLDALSDTEVAAAVGNSMFSDLVSVAGHIYKF
GVDDGLPGGVPGTKVPINLHADEFNELMGEEFIPMINKGGGAGMQVTAYTQTMSDIEAKIGNKAKAGQVI
GNFNNVFMLRVRETSTAELLTNQLPKVQVFTSTPASSANDSATGNTAFTSSSHDQVQQVSVPMIEPAHVV
GLPKGQCFALMEGGNLWKIRMPLPGHDPDEVMPADLQALAESMRQTYQVGKVDDTGWWSAPGYQTLNESL
PADLLDDFKKIAVAPEDAA
 
Nucleotide Sequence: 2160 bp     [Download]
>gi|66043271|ref|NC_007005.1|:c1643112-1640953 Pseudomonas syringae pv. syringae B728a chromosome, complete genome
ATGGCTCACGATTACGCCATTGAATCACTTCTCAGACCCGCTGTAGAGCTGTACACCGTGTACGTGTGCG
CTGCAGGTGCATTCCTGTGCGTGTTCGCTCCCTGGGCGTTTGCGCTTACTCCGCTGTTCGGCATCGTGAC
CTCCGCGGGCTTTCTCGCTTTGGGCTTAGTGCGTCTGAAACAAGCTTGGCAGGTGCTGCGCTATCGTCGA
AACATCCGTCGACTGCCTCATTACACGATGACCAGTAAAGAAGTGCCGGTGAGCAATCAACGTCTCTTCA
TCGGTCTTGGCTTCCGTTGGCAGCAGCGCCATACCCAGCGGCTGATGGACACTTACCTGCCGAAGTACGC
CAGCTACGTTGAGGCCACCTCACTGTTCCGCGCAGCGCGTCGCTTTGAGGAGAGAGCTGAGTTCGCTCCA
TACCCTGTCCGGCTTCTGGCCAGAGCAACATCATGGGACGTGCCCATCAATCCTGTGCGACCTCTGCCAC
CCGTAGGCGGCTTGCCAAGGCTGCACGGCATCGAGCCATACGAGGAGAACGTCTCTCTCCCGTTGGGCGA
GCGAGTAGGCCATTCGATTGTTCTGGGCACCACCCGTGTCGGAAAAACGCGCCTGGCTGAATTGTTCATC
ACTCAGGACATTCGGCGGAAAAAGCACGGCAAGCACGAGGTCGTCATCGTCTTTGATCCAAAGGGCGATG
CAGATTTGCTCAAGCGCATGTATCTCGAAGCCAAACGCGCCGGCCGCCTGAACGAATTTTATGTGTTCCA
CCTGGGCTGGCCAGATCACTCGGCACGCTACAACGCCGTTGGGCGTTTTGGGCGGATTTCAGAGGTGGCC
ACCAGGATCGCTGGGCAACTCTCCGGGGAAGGTAACTCAGCAGCATTCCGTGAATTCGCTTGGCGATTCG
TGAACATCATCGCAAGAGCCCTCGTCGCGCTGGGCCGTCGACCTGACTACCTGCAGATCCAGCAGCACGT
GATCAACATCGAAGGGATCTTCCAAGAGTATGCCTCTAAATACTTTGATGAATATGATCCAAAGGCCTGG
GAGGCGATCGTCGCTATTGAGGGCAAGCTCAACGAAAAAAACGTACCGTTCAACATGAAGGGCCGGCCGT
TCCGTGTGGTGGCCATCGATCAATACCTGTCTCAGACGCGCGTGGCAGATCCAGTGATGGATGGACTGCG
CAGCGCGGTCCGCTACGACAAGACCTATTTCGACAAGATCGTCGCCTCGCTGCTGCCACTGCTTGAGAAG
CTGACAACAGGCCGCATGGCGGAACTGATCTCGCCGGACTATCAGGACGTGAATGATCCTCGACCGATCT
TTGACTGGATGCAGGTGGTCCGCAAAAAGGCGGTGGTCTATATCGGCCTGGACGCCTTGTCGGACACGGA
GGTCGCGGCTGCCGTCGGCAACTCGATGTTCTCCGACCTGGTATCGGTCGCTGGCCATATCTACAAGTTC
GGTGTCGACGACGGACTACCGGGCGGCGTCCCTGGCACCAAAGTGCCTATCAACCTCCATGCCGATGAGT
TCAACGAGCTGATGGGTGAGGAATTCATTCCGATGATCAACAAGGGTGGCGGTGCCGGCATGCAGGTGAC
TGCCTACACCCAGACAATGAGCGATATCGAAGCGAAGATCGGCAACAAGGCCAAGGCTGGCCAGGTGATC
GGTAACTTCAACAACGTGTTCATGCTGCGCGTCCGCGAAACGTCCACCGCCGAGCTGCTGACAAACCAGT
TGCCTAAGGTTCAGGTTTTCACATCCACCCCGGCCAGCTCGGCGAATGACAGTGCAACGGGCAATACCGC
GTTCACATCATCCAGTCATGACCAGGTGCAGCAGGTCAGCGTGCCAATGATTGAGCCAGCGCATGTCGTC
GGCCTGCCCAAGGGCCAATGCTTCGCGCTCATGGAAGGCGGCAATCTGTGGAAAATCAGAATGCCTTTGC
CTGGCCATGATCCTGATGAAGTAATGCCGGCAGATCTGCAGGCCTTGGCGGAAAGCATGCGTCAGACGTA
TCAGGTGGGCAAGGTCGACGACACTGGCTGGTGGTCAGCGCCCGGTTATCAGACGCTAAACGAGTCGCTG
CCTGCAGATCTGCTCGACGACTTCAAAAAAATCGCTGTTGCACCTGAGGATGCGGCATGA