SecReT4
Protein ID: 70732030
T4SS name [ID]Tfc [681]
Gene symboltraD
Locus tagPFL_4696
StrainPseudomonas fluorescens Pf-5
Repliconchromosome [GenBank: NC_004129] [Browse all T4SS(s) in this replicon]
Location [Strand]5425475..5427691 [+]
Productconjugative coupling factor TraD
Component typeTfc6
UniProt IDQ4K7K4
KEGG IDpfl:PFL_4696
PDB IDNA
Domain hit(s) vs Pfam TraG-D_C [PF12696], Evalue: 9.2e-15, Aligned region: 531..659
TrwB_AAD_bind [PF10412], Evalue: 3.1e-07, Aligned region: 530..669
AAA_10 [PF12846], Evalue: 1.3e-06, Aligned region: 190..608
Protein Sequence: 738 a.a.     [Download]
>gi|70732030|ref|YP_261779.1| traD gene product [Pseudomonas fluorescens Pf-5]
MTTYSLESLLRPPVELFTTAVCYVAAALCVQAPWAFALTPLFGIATALGFAYLGTVRLLQARRVLRYQAN
LRRLPHYTMTSAEMPISNERLFIGRGFRWTQKHTQRLADTYLPQYSRYVEPTRLYEGARWLEERLEFAPF
PLKAITKVTSWDSSLNPARPLPPVGGLPRLHGIEPDEQNVSLPLGERVGHTLVLGTTRVGKTRLAEVFIT
QDIRRTHRRGSPRRMGRRSQTPHRWSRRGRPEQRPDHEVVIVFDPKGDADLLKRMYVECKRAGRLDEFYV
FHLGWPDISARYNAIGRFGRISEVATRIAGQLSGEGNSAAFREFAWRFVNIIAQSLVALGRRPDYEQIRR
HVINIDELFIEYAQKYFAEHDPKAWETIVALEAKIDRRNLSFAMKDRPLRVVAVDMYLTQKRINDSVMDG
LRSAVRYDKTYFDKIVASLLPLLEKLTTGRIAELLAPDYLDLSDQRPIFDWMQVIRKRAVVYIGLDALSD
TEVAAAVGNSMFSDLVSVAGHIYKHGIDDGLPGNMAGGKVRINLHADEFNELIGDEFIPMVNKSGGAGMQ
VTAYTQTMSDIEAKIGSKAKAGQVIGNFNNLFMLRVRETATAELLTNQLPKVQIYNSTPASSANDSLNGK
TAFTSSSHDQLQATSVPMIEPAHVVGLPKGQAFALIEGGNLWKIRMPLPANDPDEVMPGNLQDLAAGMRR
SSAASLEWWEAPGYQELKSALPEDLVEDFRQAATDDAA
 
Nucleotide Sequence: 2217 bp     [Download]
>gi|70728250|ref|NC_004129.6|:5425475-5427691 Pseudomonas fluorescens Pf-5 chromosome, complete genome
ATGACCACCTATTCACTTGAATCACTTCTACGCCCTCCGGTGGAGCTGTTCACCACGGCTGTCTGCTACG
TCGCGGCGGCACTCTGCGTTCAAGCTCCATGGGCGTTCGCACTGACACCTCTGTTCGGAATAGCCACAGC
ACTGGGCTTCGCCTACCTGGGAACAGTTCGATTACTGCAGGCGCGCAGGGTGCTGCGTTACCAGGCCAAC
CTTAGACGACTTCCCCATTACACAATGACTAGCGCTGAAATGCCGATCAGCAACGAGCGTCTATTCATCG
GCAGGGGATTTCGCTGGACGCAGAAACACACCCAACGCTTAGCTGATACCTACCTGCCCCAATACTCCAG
ATACGTCGAACCGACCAGGCTGTATGAGGGAGCGCGCTGGCTGGAGGAGCGTCTGGAATTTGCCCCCTTC
CCTCTGAAGGCAATCACAAAGGTCACCAGTTGGGACTCCAGCTTGAATCCCGCCCGGCCTCTTCCACCCG
TGGGAGGTTTGCCGAGGTTGCATGGGATAGAGCCAGATGAGCAGAACGTCAGCCTTCCACTCGGCGAGCG
GGTTGGACACACTTTGGTACTGGGGACCACCCGCGTCGGGAAAACACGGCTGGCTGAGGTTTTCATCACG
CAAGATATTCGCCGGACACATCGCCGCGGATCCCCACGGCGCATGGGTAGAAGAAGCCAAACCCCGCATC
GCTGGAGCCGGCGTGGGCGACCAGAACAACGACCTGATCATGAGGTCGTGATTGTCTTTGATCCGAAGGG
CGACGCTGATCTCCTAAAGCGCATGTATGTCGAATGCAAGCGAGCTGGGCGTCTCGATGAGTTTTATGTG
TTTCACCTGGGGTGGCCAGACATCTCCGCACGCTACAACGCTATTGGCCGCTTCGGCCGGATAAGCGAGG
TCGCAACCCGTATCGCCGGCCAGCTTTCTGGAGAAGGCAACTCAGCTGCGTTCAGGGAGTTCGCATGGCG
ATTCGTCAACATCATCGCTCAGTCGCTGGTCGCCCTCGGTCGGCGCCCAGACTACGAGCAGATCCGCCGG
CACGTGATCAACATCGACGAGCTGTTCATTGAGTACGCGCAGAAATACTTCGCTGAACATGATCCGAAGG
CATGGGAGACCATCGTTGCGCTGGAAGCGAAGATCGATCGAAGAAATCTCTCGTTCGCGATGAAAGACCG
CCCGCTGCGCGTGGTAGCCGTCGACATGTACTTGACTCAGAAACGCATCAACGACTCTGTGATGGATGGT
CTGCGCAGCGCAGTACGCTATGACAAGACCTACTTCGACAAGATCGTCGCATCCCTACTGCCGCTCCTTG
AGAAACTCACTACGGGTCGGATTGCAGAGTTACTCGCCCCGGACTACCTGGATCTTTCGGATCAGCGCCC
CATTTTCGACTGGATGCAAGTCATCCGAAAACGTGCCGTGGTTTACATCGGCCTCGATGCACTCTCGGAT
ACCGAAGTCGCCGCGGCAGTGGGCAACTCGATGTTCAGCGACTTGGTATCTGTTGCCGGCCACATCTACA
AACACGGCATCGACGACGGGCTGCCTGGAAACATGGCCGGGGGTAAGGTACGTATCAACCTCCACGCAGA
TGAGTTCAACGAACTGATCGGTGACGAGTTCATCCCGATGGTGAACAAGTCTGGCGGCGCCGGTATGCAG
GTCACTGCATATACGCAGACCATGAGCGATATCGAAGCGAAGATCGGGTCGAAAGCCAAAGCCGGCCAGG
TTATCGGTAACTTCAACAACCTGTTCATGCTACGTGTTCGGGAGACCGCGACGGCAGAACTTCTTACCAA
TCAGCTACCCAAGGTGCAGATCTACAACAGCACCCCGGCGAGCAGTGCGAACGACTCACTCAACGGTAAG
ACAGCATTCACCTCTAGCTCGCACGACCAGTTGCAGGCGACAAGCGTGCCGATGATTGAACCAGCTCATG
TAGTTGGGTTGCCGAAGGGGCAGGCTTTCGCGCTGATCGAAGGAGGCAACCTCTGGAAGATCCGAATGCC
GCTCCCCGCCAACGACCCCGATGAGGTCATGCCAGGTAACCTGCAGGACCTCGCTGCCGGCATGCGGCGA
TCATCGGCTGCATCTTTAGAGTGGTGGGAAGCCCCTGGCTATCAGGAGCTGAAAAGCGCTCTGCCTGAGG
ACCTGGTCGAAGACTTTCGCCAAGCTGCTACCGATGACGCGGCGTGA