SecReT4
Protein ID: 85372995
T4SS name [ID]Tra_F [544]
Gene symbol-
Locus tagELI_00840
StrainErythrobacter litoralis HTCC2594
Repliconchromosome [GenBank: NC_007722] [Browse all T4SS(s) in this replicon]
Location [Strand]202837..205539 [-]
Producthypothetical protein
Component typeTraG_F
UniProt IDQ2NDI1
KEGG IDeli:ELI_00840
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 5.6e-130, Aligned region: 3..462
Protein Sequence: 900 a.a.     [Download]
>gi|85372995|ref|YP_457057.1| hypothetical protein ELI_00840 [Erythrobacter litoralis HTCC2594]
MVEIFTTGGGEYIVNVLNAVAAWTGAGGYKSLIQVALVMGFALAVIVVAFNQDWRAWLNWFLGATLIYMC
LMVPRMDVQVTDRVNPSLAPATVANVPLGLALMASFTSQAGDYLTRSAETVFGLPDDLNYSKNGMIYGAR
LLEATRSLRIADPEFAANFDEHVRQCVFYDLLLGRYSMKEFSESNDIWATIAPGSAARAQKFLTREADDR
VSASIVTCREAYTALSNQWAGMIDDMTLVAGRQLYPKQTEALAKAKLIADLPVAYQYLTGVSKDASSIFR
QVLTINAMNQAMHGFAGASGASSVDVFAQTRADIQTERTYSSIAHNAMKWVPILNVVLTVVFYALFPVLF
PLFLMPRTGPIALRGYVTGFFYLAAWGPLFVILHMILMLKGAGDVAAAGGASGLTLATFSGMTDVNNDIG
ILAGYLVASIPFLAGGVARGAMAISGQATSYLNPSQNAAEEAAREASTGNLSLGNTSLENSNVFSRQFAQ
ASLAPNIAYGAAQSRGFADNGTQTTSFPQAEFATVPTSSYPFTPTLGQDFSSRLATMASQSRGQSETFSN
LAQQSTSSAVTRFSELRDAYTRSRSNESVSGVSTSDSIGSAFSEVDNASKTLQQQFGLSRRAADDITVSW
FLNGDAGLGVKGERGSVKGTLGLKGGRNQTWTDSDIGIASEDRSRIMGALRQISDSRSWSSTREGFLRET
SSSSEALVSSSSAGITTSITEAQSYTREARRAEEIASRLENQASWYESANVAGTLNLSQAYREWGMAEID
ANRDYYGPVRFDDIDFQMSARGQQLQVRFVESYADQLNADIADDLVLPPFAPVARPAVESADGVRGSVRL
GGVQGSLGEPSSEREEIARDVDRVQQQGERRVGTVKGYLDGKTRDAKGASAEAADDVKEW
 
Nucleotide Sequence: 2703 bp     [Download]
>gi|85372828|ref|NC_007722.1|:c205539-202837 Erythrobacter litoralis HTCC2594 chromosome, complete genome
ATGGTCGAGATCTTCACCACCGGCGGCGGCGAGTACATCGTCAATGTCCTCAACGCCGTCGCCGCATGGA
CCGGTGCGGGCGGCTACAAAAGCCTGATCCAGGTCGCGCTGGTAATGGGGTTCGCGCTTGCGGTGATCGT
GGTGGCGTTCAACCAGGACTGGCGAGCGTGGCTCAACTGGTTCCTCGGCGCGACGCTCATCTACATGTGC
CTGATGGTGCCGCGCATGGATGTGCAGGTCACCGATCGCGTCAATCCGAGCCTTGCTCCGGCCACTGTTG
CGAACGTCCCGCTGGGCCTCGCGCTGATGGCAAGCTTCACCAGCCAGGCTGGAGACTACCTCACGCGCTC
GGCCGAGACCGTGTTCGGGCTTCCCGACGATCTCAATTATTCGAAGAACGGCATGATCTACGGCGCGCGC
CTGCTCGAAGCGACACGCTCGCTGCGCATCGCCGATCCTGAGTTCGCCGCCAATTTCGACGAACACGTTC
GCCAATGCGTTTTCTACGATCTGCTGCTCGGTCGCTACTCGATGAAGGAATTTTCCGAGAGCAATGACAT
CTGGGCGACCATTGCGCCCGGGAGCGCGGCACGCGCGCAGAAGTTCCTCACCCGCGAAGCCGATGACAGG
GTTTCCGCCTCGATCGTCACCTGCCGCGAGGCCTACACCGCGCTCTCGAACCAGTGGGCGGGGATGATCG
ACGACATGACGCTCGTTGCCGGCCGCCAGCTCTACCCTAAGCAAACCGAAGCGCTCGCCAAGGCCAAGCT
CATCGCCGATCTGCCGGTGGCTTACCAATATCTTACCGGGGTCTCGAAGGACGCGAGCAGCATTTTTCGC
CAGGTCTTGACCATCAACGCGATGAACCAGGCAATGCACGGCTTTGCCGGAGCAAGCGGCGCATCGAGCG
TCGATGTATTCGCGCAGACCCGCGCCGATATCCAGACCGAGCGAACGTATTCCTCGATCGCGCACAATGC
GATGAAATGGGTGCCGATCCTCAATGTCGTGCTGACCGTGGTCTTCTACGCGCTTTTCCCGGTACTCTTC
CCGCTGTTCCTGATGCCGCGGACCGGTCCGATCGCGCTGCGCGGCTATGTCACGGGCTTCTTCTACCTCG
CCGCCTGGGGGCCGCTGTTCGTCATCCTCCACATGATCCTGATGCTTAAAGGCGCGGGCGATGTCGCCGC
TGCGGGCGGTGCAAGCGGGCTCACGCTCGCGACCTTCTCCGGCATGACCGACGTCAACAATGATATCGGT
ATCCTTGCCGGCTATCTTGTCGCCTCGATCCCCTTCCTTGCGGGCGGCGTCGCGCGCGGGGCCATGGCGA
TCTCTGGACAGGCGACAAGCTACCTCAATCCGAGCCAGAACGCGGCCGAGGAAGCCGCACGCGAGGCGAG
CACGGGCAATCTCTCGCTTGGCAACACCAGCCTTGAGAACTCGAACGTCTTCTCGCGCCAGTTTGCCCAG
GCGAGCCTTGCACCAAACATCGCCTATGGCGCAGCGCAGTCGCGCGGCTTTGCCGACAACGGCACGCAAA
CGACCAGCTTCCCGCAAGCCGAGTTCGCGACCGTGCCGACCTCGAGCTACCCATTTACACCGACGCTTGG
GCAGGACTTCTCGAGCAGGCTCGCGACCATGGCGAGCCAGAGCCGCGGCCAAAGCGAGACCTTTTCCAAC
CTTGCCCAGCAATCGACCAGCTCGGCGGTCACCCGCTTCAGCGAACTGCGCGATGCCTACACCCGCTCGC
GCTCGAACGAGAGTGTCAGTGGGGTCTCGACCAGCGACAGCATCGGCAGCGCCTTCAGCGAAGTCGACAA
CGCTTCGAAGACACTCCAGCAGCAATTCGGGCTGTCGCGCCGTGCCGCCGACGACATCACCGTCTCGTGG
TTCTTGAATGGGGATGCCGGTCTTGGGGTCAAAGGAGAACGAGGTTCGGTCAAGGGTACCCTTGGGTTGA
AAGGTGGCCGGAACCAGACCTGGACTGACAGTGATATCGGGATCGCCTCCGAGGACCGCTCACGCATCAT
GGGTGCGCTGCGTCAGATCTCGGACAGTCGCAGCTGGTCGAGCACGCGCGAGGGTTTCCTGCGCGAGACG
AGCTCAAGCTCCGAAGCGCTGGTTTCGAGCAGTTCGGCCGGCATCACCACGTCGATCACCGAAGCGCAGA
GCTATACCCGCGAAGCACGCCGCGCCGAGGAAATCGCCAGCCGCCTTGAGAACCAGGCAAGCTGGTACGA
AAGTGCCAATGTCGCAGGCACGCTCAATCTCAGCCAGGCCTATCGCGAATGGGGCATGGCCGAGATCGAC
GCCAATCGGGATTACTACGGGCCAGTGCGCTTCGACGACATCGACTTCCAGATGAGTGCGCGAGGCCAGC
AGCTCCAGGTGCGGTTCGTCGAAAGCTATGCGGACCAGCTCAACGCCGATATCGCGGACGACCTGGTTCT
GCCGCCCTTTGCGCCCGTCGCTCGACCCGCGGTGGAGAGCGCAGATGGTGTCCGGGGATCGGTACGGCTT
GGCGGGGTACAAGGAAGCCTAGGTGAACCTTCTAGCGAGCGCGAGGAAATCGCCCGAGATGTCGATCGGG
TCCAGCAACAAGGGGAACGGCGGGTCGGGACCGTGAAAGGATACCTCGACGGCAAGACCCGCGATGCCAA
GGGAGCCTCGGCCGAAGCGGCCGACGATGTGAAGGAATGGTAG