SecReT4
Protein ID: 85372996
T4SS name [ID]Tra_F [544]
Gene symbol-
Locus tagELI_00845
StrainErythrobacter litoralis HTCC2594
Repliconchromosome [GenBank: NC_007722] [Browse all T4SS(s) in this replicon]
Location [Strand]205547..206983 [-]
Productpilus assembly protein
Component typeTraH_F
UniProt IDQ2NDI0
KEGG IDeli:ELI_00845
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 2.5e-113, Aligned region: 30..391
Protein Sequence: 478 a.a.     [Download]
>gi|85372996|ref|YP_457058.1| pilus assembly protein [Erythrobacter litoralis HTCC2594]
MITSIRNAALTLAAASMIASPLAANVGDSMDRFMDDMGAAANVTGPTAFEGQSAGYYSLGNVWTRFPQKT
TSIANLQLPRARAGCGGIDIFAGSFSFINASEMVALLKAVANNAVGFAFSLAIDTVCPECNKIMQEFSQK
AQLMNNLSINSCEMAQGLVGGLWPKGDLADKAICEAIGNSEGIFTDYAAAKHGCGTRGQRASTNEGAGAD
YADVNPGVARNYTWHVLKKSAFFNPGGTFDRELAEYAMTLIGTVIYVPPKDDEAGKFVPFAGDASSTLVS
ALLDGTQGQTVRVFRCDETDLCLNPTFEQMSLANAKAIRPRVALLIGNMVDAIRADTAIGNAEKELLQVA
SVPLYKILTVQAAYGRGMPTDDRDTLAEIASIDLLYAILDRIVSEAGRSMASFIAADEAKLAIWRGQVAE
VRTGLVQRQATGQAKVSAIMQIIEKTAMIENALAASMSPSMSAALDWSRGLQSRSIVP
 
Nucleotide Sequence: 1437 bp     [Download]
>gi|85372828|ref|NC_007722.1|:c206983-205547 Erythrobacter litoralis HTCC2594 chromosome, complete genome
ATGATTACTAGCATTCGCAATGCGGCGCTGACCCTCGCCGCCGCCAGCATGATCGCTTCCCCGCTTGCCG
CCAACGTTGGCGACAGCATGGACCGCTTCATGGACGACATGGGCGCGGCGGCCAATGTCACGGGTCCGAC
CGCCTTCGAAGGCCAGTCGGCAGGCTATTACAGCCTCGGCAATGTCTGGACGCGCTTCCCCCAGAAGACG
ACTAGCATCGCCAATCTCCAGCTGCCGCGTGCCCGCGCTGGTTGCGGCGGTATCGATATCTTCGCCGGGT
CCTTCTCCTTCATCAACGCAAGCGAGATGGTCGCGCTTCTGAAGGCGGTCGCGAACAACGCGGTCGGGTT
CGCCTTCAGCCTCGCGATCGATACCGTTTGCCCCGAGTGCAACAAGATCATGCAGGAGTTCAGCCAGAAG
GCGCAACTCATGAACAACCTCTCGATCAACTCCTGCGAAATGGCGCAGGGGCTGGTCGGCGGCCTGTGGC
CCAAGGGTGATTTGGCCGACAAGGCGATCTGCGAAGCAATCGGCAATTCGGAAGGCATCTTCACCGACTA
TGCCGCGGCCAAGCACGGCTGCGGCACGCGCGGGCAGCGCGCCTCGACCAATGAAGGCGCCGGTGCCGAT
TACGCCGACGTCAATCCCGGCGTAGCCCGCAACTACACCTGGCACGTCCTCAAGAAGAGCGCCTTTTTCA
ACCCCGGTGGCACTTTCGACCGCGAGCTTGCCGAATACGCCATGACGCTCATCGGCACGGTGATCTACGT
GCCGCCCAAGGACGATGAGGCAGGCAAGTTCGTGCCATTTGCAGGCGATGCGTCGTCCACCCTGGTGAGC
GCGCTGCTCGACGGGACGCAGGGCCAGACGGTCAGGGTGTTCCGCTGCGACGAGACCGATCTTTGCCTCA
ATCCGACCTTCGAACAGATGAGCCTTGCCAACGCCAAGGCGATCCGCCCGCGCGTCGCGCTGCTGATCGG
CAACATGGTCGATGCGATCCGCGCCGACACCGCGATCGGCAATGCCGAGAAGGAACTGCTGCAAGTAGCC
TCGGTCCCCTTGTACAAGATCCTCACCGTCCAGGCCGCCTATGGGCGCGGCATGCCGACCGATGATCGCG
ACACGCTCGCCGAGATCGCCAGCATCGACCTCCTCTATGCGATCCTCGACCGGATCGTGTCCGAAGCCGG
GCGCTCGATGGCAAGCTTCATCGCCGCCGACGAAGCCAAGCTCGCGATCTGGCGCGGCCAGGTCGCCGAG
GTTCGCACTGGCCTCGTCCAGCGGCAGGCGACCGGACAGGCCAAGGTCTCGGCGATCATGCAGATCATCG
AGAAGACCGCGATGATCGAGAACGCGCTCGCCGCCTCGATGTCGCCTTCGATGTCCGCCGCGCTCGACTG
GTCGCGTGGACTGCAGTCGCGCTCGATCGTCCCCTGA