SecReT4
Protein ID: 85372999
T4SS name [ID]Tra_F [544]
Gene symbol-
Locus tagELI_00860
StrainErythrobacter litoralis HTCC2594
Repliconchromosome [GenBank: NC_007722] [Browse all T4SS(s) in this replicon]
Location [Strand]209503..210258 [-]
Producthypothetical protein
Component typeTrbC_F
UniProt IDQ2NDH7
KEGG IDeli:ELI_00860
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 1.7e-27, Aligned region: 117..228
Protein Sequence: 251 a.a.     [Download]
>gi|85372999|ref|YP_457061.1| hypothetical protein ELI_00860 [Erythrobacter litoralis HTCC2594]
MRNAFHLLVLISLATAAAFAAASAQDSPPDLDLAEIRARASEHAQDAEALATSVRTRADTLAEDARTTQQ
AALDNRAAYVKEAQASAGVGPLDLDGMIRSAADAEVAAMGEVPRFIAFASLSMPEPSLKALVRDVTRAGG
VTVLRGFPQGDSAAFKKRLAAIWRDGSEAGALGIDPRLFRTFDIAVAPSFVMVASDFSPCDGFDCTDTLP
PHDRIAGNVSVEDALETFADGGGPGAQLARLHLARLRDQRP
 
Nucleotide Sequence: 756 bp     [Download]
>gi|85372828|ref|NC_007722.1|:c210258-209503 Erythrobacter litoralis HTCC2594 chromosome, complete genome
ATGAGAAACGCCTTCCATCTCCTCGTCCTCATCAGCCTGGCAACAGCCGCTGCCTTCGCTGCCGCATCGG
CGCAGGATTCTCCGCCCGATCTCGACCTTGCCGAGATCCGCGCCCGCGCGAGCGAGCATGCCCAGGATGC
CGAAGCACTCGCGACTTCGGTCAGGACCAGGGCCGACACGCTGGCCGAGGACGCACGAACCACGCAGCAG
GCGGCACTCGACAACCGCGCCGCCTATGTGAAGGAAGCGCAGGCGAGTGCCGGCGTCGGTCCGCTCGATC
TCGACGGCATGATCCGCAGCGCAGCCGACGCCGAGGTCGCGGCGATGGGCGAAGTACCGCGCTTCATTGC
CTTTGCTTCGTTGTCGATGCCCGAGCCTTCCTTGAAGGCGCTGGTCCGCGACGTCACCCGCGCCGGCGGG
GTCACCGTGCTGCGCGGCTTCCCGCAAGGCGACAGCGCGGCCTTCAAGAAGCGGCTCGCCGCGATCTGGC
GCGATGGCAGCGAGGCCGGCGCGCTCGGGATCGATCCGCGGCTGTTCCGCACTTTCGATATCGCTGTCGC
ACCGAGCTTCGTGATGGTCGCGAGCGATTTCAGCCCCTGCGACGGGTTCGATTGCACCGACACTTTACCG
CCGCACGACCGAATCGCGGGCAATGTCAGCGTCGAGGACGCGCTCGAAACCTTTGCCGATGGCGGCGGCC
CGGGCGCGCAGCTTGCCCGCCTCCACCTCGCCCGCCTGAGGGATCAGCGCCCATGA