SecReT4
Protein ID: 85373010
T4SS name [ID]Tra_F [544]
Gene symbol-
Locus tagELI_00915
StrainErythrobacter litoralis HTCC2594
Repliconchromosome [GenBank: NC_007722] [Browse all T4SS(s) in this replicon]
Location [Strand]219271..219840 [-]
Productconjugative transfer protein TraE
Component typeTraE_F
UniProt IDQ2NDG6
KEGG IDeli:ELI_00915
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 5e-66, Aligned region: 1..183
Protein Sequence: 189 a.a.     [Download]
>gi|85373010|ref|YP_457072.1| conjugative transfer protein TraE [Erythrobacter litoralis HTCC2594]
MKHEFAYEEAQRHLRQRNRFAALASVLGLTSLLAVGAAATREESVILVPVTSERLTLGSDATDAHYLELV
TRDTALMLLNRAPESLDYWMEQVLKVADPAAHGSFKAELVKIVDEQRGSDISQAFVISRMEVDPQALTAV
VTGTLKTFVGAQVIASQQRSFEFSWNRRGLSLGLTGFRQLPNENEEEGQ
 
Nucleotide Sequence: 570 bp     [Download]
>gi|85372828|ref|NC_007722.1|:c219840-219271 Erythrobacter litoralis HTCC2594 chromosome, complete genome
ATGAAACACGAATTCGCCTACGAGGAAGCGCAGCGCCACTTGCGCCAGCGCAACCGCTTCGCCGCGCTGG
CGTCCGTTCTCGGCCTCACCAGCCTTCTCGCGGTCGGCGCTGCGGCAACGCGCGAAGAGTCTGTGATCCT
CGTACCCGTCACCTCCGAACGCCTGACGCTCGGGAGCGATGCAACCGATGCGCACTACCTCGAACTCGTC
ACTCGCGACACTGCGCTGATGCTGCTCAACCGTGCGCCCGAGAGCCTCGACTACTGGATGGAACAGGTCC
TGAAAGTCGCTGACCCGGCCGCGCACGGGAGCTTCAAGGCCGAACTCGTCAAGATCGTCGACGAACAACG
CGGCTCGGACATCAGCCAGGCTTTCGTGATTTCGCGGATGGAGGTCGACCCGCAGGCGCTCACCGCCGTC
GTCACCGGCACGCTCAAGACCTTCGTCGGCGCGCAGGTGATCGCGAGCCAGCAGCGCAGCTTCGAATTCA
GCTGGAACCGCCGCGGCCTCAGCCTCGGCCTCACCGGCTTCCGCCAGCTTCCCAACGAGAACGAGGAGGA
AGGCCAATGA