SecReT4
Protein ID: 85375787
T4SS name [ID]Tra_F [546]
Gene symbol-
Locus tagELI_14800
StrainErythrobacter litoralis HTCC2594
Repliconchromosome [GenBank: NC_007722] [Browse all T4SS(s) in this replicon]
Location [Strand]2988396..2989409 [-]
Producthypothetical protein
Component typeTraU_F
UniProt IDQ2N5I9
KEGG IDeli:ELI_14800
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 6.6e-78, Aligned region: 35..336
Protein Sequence: 337 a.a.     [Download]
>gi|85375787|ref|YP_459849.1| hypothetical protein ELI_14800 [Erythrobacter litoralis HTCC2594]
MSSIRAFLILMTATLSLAFASPASADAGPGKCTGSFVNPITDICWSCLFPISIGGLDIWPSNRPDPDNPD
LPVCLCGIRPGIAMGFWEPVRLADVSMKPWCFVNLGGTKLDPGFDIGFRSISGPSAVGGASQYYSSWHVH
WYAYPLIYWMEIVADFLCLEPGSIDILYISEIDPLWQDSELTAIINPEAVLFANPLALAACAADCAASTA
KLPIDEMFWCAGCQGSMYPMNGNVSASIGHVQASRLVLSRFAYKLHRELVSWGTMGSKGLCGKYLMPVMR
KQQYRFQATNPNPATSGRYACPPIGTSTTLQEPGQMIPAIGEDMGYLVWRKRNCCAL
 
Nucleotide Sequence: 1014 bp     [Download]
>gi|85372828|ref|NC_007722.1|:c2989409-2988396 Erythrobacter litoralis HTCC2594 chromosome, complete genome
ATGAGCAGCATCCGCGCTTTCCTGATCCTCATGACGGCGACACTTTCGCTCGCTTTTGCCTCGCCAGCTT
CGGCCGATGCGGGTCCGGGCAAATGCACCGGCAGTTTCGTCAACCCGATCACCGACATCTGCTGGTCATG
CCTTTTCCCGATCTCCATCGGCGGGCTGGATATCTGGCCGAGCAATCGACCTGATCCCGACAATCCCGAT
CTCCCGGTCTGCCTTTGCGGGATCCGGCCCGGCATCGCGATGGGGTTCTGGGAGCCGGTCCGCCTTGCCG
ATGTCAGCATGAAGCCGTGGTGCTTCGTGAACCTTGGCGGCACAAAACTCGATCCCGGCTTCGATATCGG
GTTCCGTTCGATCTCAGGACCGTCCGCCGTAGGCGGTGCCAGCCAGTATTATTCGAGCTGGCACGTCCAC
TGGTATGCCTATCCGCTGATCTACTGGATGGAGATCGTCGCCGATTTCCTGTGCCTCGAGCCGGGATCAA
TCGATATCCTCTACATCTCCGAGATCGATCCGCTGTGGCAGGACAGCGAGCTCACTGCGATCATCAATCC
TGAAGCGGTGCTCTTTGCCAATCCGTTAGCGCTCGCCGCCTGCGCTGCTGATTGCGCGGCTTCGACCGCC
AAGCTGCCAATCGACGAGATGTTCTGGTGCGCAGGCTGTCAGGGCTCGATGTATCCGATGAACGGCAATG
TTTCGGCCTCGATCGGGCATGTCCAGGCCTCGCGGCTCGTGCTTTCTCGCTTCGCTTACAAGCTGCACCG
TGAACTCGTCTCGTGGGGCACGATGGGGTCTAAAGGCTTGTGCGGCAAATACCTGATGCCGGTGATGCGA
AAGCAGCAATACCGCTTCCAGGCCACCAATCCCAATCCGGCGACAAGCGGACGCTACGCCTGCCCGCCGA
TCGGCACCTCCACCACGCTTCAGGAACCCGGACAGATGATCCCCGCCATTGGCGAAGACATGGGATACCT
CGTCTGGCGCAAGAGGAATTGCTGCGCACTATGA