SecReT4
Protein ID: 85375793
T4SS name [ID]Tra_F [546]
Gene symbol-
Locus tagELI_14830
StrainErythrobacter litoralis HTCC2594
Repliconchromosome [GenBank: NC_007722] [Browse all T4SS(s) in this replicon]
Location [Strand]2993852..2994424 [-]
Producthypothetical protein
Component typeTraV_F
UniProt IDQ2N5I3
KEGG IDeli:ELI_14830
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 7.9e-09, Aligned region: 75..103
Protein Sequence: 190 a.a.     [Download]
>gi|85375793|ref|YP_459855.1| hypothetical protein ELI_14830 [Erythrobacter litoralis HTCC2594]
MSRPPILRTTALPAALLLASGCTSFGTNVNGNFACRAPDGTCAPTSMIDAGATGIDRGDVKHVHRPVPQT
DEAVRRLQVVIAAYRDEAGRDHEARVVHVTLPEAVGTGRRAPQGRRDILRSLGANIAATREEITAPQNNH
DEPLPEQLFIPLQPVPAMPGANAPEPGGPGSFVPPREPVPHPDKYEGESQ
 
Nucleotide Sequence: 573 bp     [Download]
>gi|85372828|ref|NC_007722.1|:c2994424-2993852 Erythrobacter litoralis HTCC2594 chromosome, complete genome
ATGAGCCGGCCCCCGATCCTTCGAACAACCGCTCTGCCAGCAGCGCTGCTTTTGGCGAGCGGATGCACCA
GCTTCGGGACCAATGTGAACGGCAATTTTGCCTGCCGCGCGCCCGATGGAACCTGCGCGCCCACTTCGAT
GATCGATGCCGGGGCAACCGGCATCGACCGAGGCGACGTCAAACACGTGCACCGCCCTGTGCCGCAAACA
GACGAAGCCGTTCGCCGCCTGCAGGTCGTCATCGCGGCCTACCGCGACGAAGCAGGCCGTGACCACGAAG
CGCGGGTTGTGCACGTGACGCTGCCTGAAGCTGTCGGAACGGGCCGGCGCGCACCGCAAGGGCGGAGGGA
TATCCTTCGCTCGCTGGGCGCGAACATCGCTGCAACCCGCGAAGAGATCACCGCACCTCAAAACAATCAC
GACGAACCATTGCCGGAACAGCTGTTTATCCCCCTGCAGCCCGTTCCGGCGATGCCCGGCGCCAACGCGC
CGGAACCCGGGGGACCCGGCTCGTTTGTCCCTCCCCGCGAGCCGGTCCCCCATCCTGACAAATATGAAGG
AGAAAGCCAGTGA