SecReT6
Protein ID: 104779787
SecReT6 ID125
T6SS typei1
Gene symbol-
Locus tagPSEEN0522
StrainPseudomonas entomophila L48
Repliconchromosome [GenBank: NC_008027] [Browse all T6SS(s) in this replicon]
Location [Strand]537545..539101 [+]
Producthypothetical protein
NoteTssA
UniProt IDQ1IFT4
KEGG IDpen:PSEEN0522
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.00E-23, Aligned region: 55..115
Protein Sequence: 518 a.a.     [Download]
>gi|104779787|ref|YP_606285.1| hypothetical protein PSEEN0522 [Pseudomonas entomophila L48]
MSYSSKLAARYLELGKNAVSPGSFGGDDVRFSTEFEALEGELTRAQSIHASGQVDWLKILENSEALLRDQ
SKDLRVASWLTWALFQRESYAGLLAGISLLRELCEHHWDDVHPAKPRTRSAAIGWLVPRLEQALGADIAI
KEQLPLFQQMVEQLAGLEAALSARLGDDAPLLLPICRALKGQVQRSADNEPQPGAVGAIVAQVKQAATQL
FTPGEPVENEKDANKALRAQQEQGRQLCVWWQRQKATDLRALRLNRTLLWLPIEAMPERNAENVTALRGL
PADKLKSYRERFEQGNYADLLVELENSVAKAPFWFDGQRLVWECCQALNVEAGMREVEMNFASLLQRLPS
VIELKFHDGTPFADPETRAWVAAQVTPHLQAEVAQPVAEPGMRQMPWEEALEAVQPILRKDGLKSAVQHL
KQQMQGAHGGRERFFWQLSQARLCYTAKKYELAKTQLEALDEQLRQSGVDAWEPDLSLQVLHLLHTCCEL
LPQNHVVRERKDEIYRRLCHLDLEVVLE
 
Nucleotide Sequence: 1557 bp     [Download]
>gi|104779316|ref|NC_008027.1|:537545-539101 Pseudomonas entomophila L48 chromosome, complete genome
ATGTCTTATTCTTCTAAACTGGCTGCGCGCTATCTCGAACTCGGCAAGAATGCCGTCTCGCCGGGCTCCT
TCGGTGGTGACGACGTGCGCTTCTCCACCGAGTTCGAAGCCCTCGAAGGTGAGCTGACCCGGGCCCAGTC
GATCCATGCCAGCGGCCAGGTGGACTGGCTGAAGATCCTCGAGAACAGTGAAGCGCTGCTACGCGACCAG
TCCAAGGATCTGCGCGTGGCCTCCTGGCTGACCTGGGCCCTGTTCCAGCGCGAATCCTACGCCGGCCTGC
TGGCGGGTATCAGCCTGCTGCGCGAGCTGTGCGAGCACCATTGGGACGACGTCCACCCCGCCAAACCCCG
TACCCGTTCCGCCGCCATCGGTTGGCTGGTGCCGCGCCTCGAGCAGGCGCTGGGCGCCGACATCGCGATC
AAGGAGCAGTTGCCGCTGTTCCAGCAGATGGTCGAGCAACTGGCTGGCCTGGAGGCGGCGTTGTCTGCCC
GGCTGGGCGACGATGCGCCGCTGCTGCTGCCCATCTGCCGCGCCCTCAAGGGCCAGGTCCAGCGTTCGGC
CGACAACGAGCCGCAGCCCGGCGCGGTCGGCGCCATCGTCGCCCAGGTCAAGCAGGCGGCCACCCAGCTG
TTCACCCCGGGCGAGCCGGTAGAGAACGAGAAGGATGCGAATAAAGCCCTGCGCGCCCAGCAAGAGCAGG
GCCGGCAGCTGTGCGTGTGGTGGCAGCGACAGAAAGCCACCGACCTGCGCGCCCTGCGCCTGAACCGCAC
GCTGCTGTGGCTGCCCATCGAGGCGATGCCCGAGCGTAACGCCGAAAACGTCACCGCCTTGCGCGGCCTG
CCCGCCGACAAGCTCAAGAGCTACCGCGAGCGTTTCGAACAGGGCAACTACGCCGACCTGCTGGTGGAAC
TGGAGAACAGCGTGGCCAAGGCGCCGTTCTGGTTCGATGGCCAGCGCCTGGTGTGGGAATGCTGCCAGGC
CCTGAACGTCGAGGCCGGCATGCGCGAGGTGGAGATGAACTTCGCCTCGCTGCTGCAGCGCCTGCCCAGC
GTGATCGAGCTGAAGTTCCATGACGGCACCCCCTTCGCCGACCCCGAGACCCGCGCCTGGGTCGCCGCCC
AGGTCACCCCTCACTTGCAGGCCGAGGTGGCTCAGCCGGTGGCCGAGCCCGGCATGCGCCAGATGCCCTG
GGAGGAAGCCCTGGAGGCGGTGCAGCCGATCCTGCGCAAGGATGGCCTCAAGAGCGCGGTGCAACACCTC
AAACAGCAGATGCAGGGCGCCCACGGCGGGCGCGAGCGCTTTTTCTGGCAACTCAGCCAGGCGCGCCTCT
GCTACACGGCCAAGAAATACGAACTGGCCAAGACCCAGCTGGAAGCCCTCGACGAGCAACTGCGCCAATC
CGGCGTGGATGCCTGGGAACCCGACCTGTCGCTGCAGGTGCTGCACCTGCTGCATACCTGTTGCGAGCTG
CTGCCGCAGAACCATGTGGTGCGCGAACGCAAGGACGAGATCTACCGCCGACTGTGCCATCTCGATCTCG
AAGTCGTACTCGAATAG