SecReT6
Protein ID: 104779788
SecReT6 ID125
T6SS typei1
Gene symbol-
Locus tagPSEEN0523
StrainPseudomonas entomophila L48
Repliconchromosome [GenBank: NC_008027] [Browse all T6SS(s) in this replicon]
Location [Strand]539135..539635 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ1IFT3
KEGG IDpen:PSEEN0523
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.70E-53, Aligned region: 5..159
Protein Sequence: 166 a.a.     [Download]
>gi|104779788|ref|YP_606286.1| hypothetical protein PSEEN0523 [Pseudomonas entomophila L48]
MAKEGSVAPKERINVTFKPATGGAQEEIELPLKLLAIGDYTLRADDRKIEDRKPISIDKMNFDEVLAKQE
LSMTLAVPNRLQEGAEGDELAVSLRVNTMKDFNPASLVEQVPELKKLMELREALVALKGPLGNAPAFRKA
IEGVLADGESRERVLGELGLNAAPDA
 
Nucleotide Sequence: 501 bp     [Download]
>gi|104779316|ref|NC_008027.1|:539135-539635 Pseudomonas entomophila L48 chromosome, complete genome
ATGGCCAAAGAAGGCTCGGTAGCCCCCAAGGAACGCATCAACGTCACGTTCAAACCCGCCACCGGTGGGG
CTCAGGAAGAGATCGAACTGCCGTTGAAACTACTGGCGATCGGTGACTACACCCTGCGTGCCGACGATCG
CAAGATCGAAGACCGCAAGCCGATCAGCATCGACAAGATGAACTTCGACGAGGTGCTGGCCAAGCAGGAA
CTGAGCATGACCCTGGCCGTGCCCAACCGCCTGCAGGAAGGTGCCGAAGGCGACGAGCTGGCGGTCAGCC
TGCGCGTCAACACCATGAAGGACTTCAACCCGGCCAGCCTGGTCGAGCAAGTGCCGGAGCTGAAGAAGCT
GATGGAACTGCGTGAAGCCCTGGTTGCCCTGAAAGGCCCGCTGGGCAACGCCCCGGCGTTCCGCAAGGCC
ATCGAAGGCGTGCTGGCCGACGGCGAGTCCCGCGAGCGCGTGCTCGGTGAGCTGGGCCTGAACGCCGCGC
CTGACGCCTGA