SecReT6
Protein ID: 104779789
SecReT6 ID125
T6SS typei1
Gene symbol-
Locus tagPSEEN0524
StrainPseudomonas entomophila L48
Repliconchromosome [GenBank: NC_008027] [Browse all T6SS(s) in this replicon]
Location [Strand]539663..541135 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ1IFT2
KEGG IDpen:PSEEN0524
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 5.20E-191, Aligned region: 63..488
Protein Sequence: 490 a.a.     [Download]
>gi|104779789|ref|YP_606287.1| hypothetical protein PSEEN0524 [Pseudomonas entomophila L48]
MSTAAQQQSAENSEFSILDSIIAETRLTPDDEAYDIAKRGVSAFIEELLKPQNDGEPVKKALVDRMIAEI
DAKLSRQMDEILHHPDFQAMESAWRGLQLLVDRTNFRENIKIEILNVSKQDLLDDFEDSPEVMQAGLYKH
IYTAEYGQFGGQPVGAVIANYYLSPSSPDVKLMQYVSSVSCMSHAPFIAAAGPKFFGLESFTGLPDLKDL
KDHFEGPQFTKWQSFRESEDARYIGLTVPRFLLRNPYDPEENPVKSFVYKETVANSHEHYLWGNTAYAFG
TKLTDSFAKFRWCPNIIGPQSGGAVEDLPLHHFESMGEIETKIPTEVLVSDRREYELAEEGFIALTMRKG
SDNAAFFSANSAQKPKFFGISAEGKTAELNYKLGTQLPYMMIVNRLAHYIKVLQREQLGSWKERTDLELE
LNKWIRQYVADQENPSAEVRGRRPLRAAQVIVSDVEGEPGWYRVSLNVRPHFKYMGADFTLSLVGKLDKE
 
Nucleotide Sequence: 1473 bp     [Download]
>gi|104779316|ref|NC_008027.1|:539663-541135 Pseudomonas entomophila L48 chromosome, complete genome
ATGAGCACCGCCGCACAACAACAGAGCGCCGAGAACAGCGAATTCAGCATTCTCGACAGCATCATCGCCG
AAACCCGCCTGACCCCGGACGACGAAGCCTACGACATCGCCAAGCGTGGCGTGTCGGCCTTCATCGAAGA
GCTGCTCAAGCCGCAGAACGACGGTGAGCCGGTCAAGAAGGCGCTGGTCGACCGCATGATCGCCGAGATC
GATGCCAAGCTCAGCCGCCAGATGGACGAGATCCTCCACCACCCGGACTTCCAGGCCATGGAATCGGCCT
GGCGCGGGCTGCAGCTGCTGGTCGATCGCACCAACTTCCGTGAAAACATCAAGATCGAGATCCTCAACGT
CTCCAAGCAGGACCTGCTGGACGACTTCGAAGACTCGCCGGAAGTGATGCAGGCTGGCCTGTACAAGCAT
ATCTACACCGCCGAATACGGCCAGTTCGGTGGCCAGCCGGTCGGCGCGGTCATCGCCAACTACTACCTGT
CGCCGAGCTCGCCTGACGTCAAGCTGATGCAGTACGTCTCCAGCGTCTCCTGCATGTCCCACGCGCCGTT
CATCGCCGCTGCCGGCCCGAAATTCTTCGGCCTGGAAAGCTTCACCGGTCTGCCGGACCTGAAGGACCTG
AAGGATCACTTCGAAGGCCCGCAGTTCACCAAGTGGCAGAGCTTCCGCGAGTCCGAGGACGCGCGCTACA
TCGGCCTGACCGTGCCGCGCTTCCTGCTGCGCAACCCGTACGACCCGGAGGAGAACCCGGTCAAGTCGTT
CGTCTACAAGGAAACCGTGGCCAACAGCCACGAGCACTACCTGTGGGGCAACACTGCGTACGCCTTCGGT
ACCAAGCTCACCGACAGCTTCGCCAAGTTCCGCTGGTGCCCGAACATCATCGGCCCGCAGAGCGGTGGCG
CGGTGGAAGACCTGCCGCTGCACCACTTCGAGAGTATGGGCGAGATCGAGACCAAGATCCCGACCGAAGT
GCTGGTGTCCGACCGTCGCGAGTACGAGCTGGCCGAAGAGGGCTTCATTGCCCTGACCATGCGCAAGGGC
AGCGACAACGCGGCGTTCTTCTCGGCCAACTCGGCGCAGAAACCGAAGTTCTTCGGTATCAGCGCAGAAG
GCAAGACCGCCGAGCTGAACTACAAGCTGGGCACCCAGCTGCCGTACATGATGATCGTCAACCGCCTGGC
CCACTACATCAAGGTCCTGCAGCGCGAGCAGCTGGGCTCCTGGAAGGAACGCACCGACCTGGAGCTGGAA
CTGAACAAGTGGATCCGCCAGTACGTGGCCGACCAGGAGAACCCGAGCGCCGAAGTACGTGGCCGTCGTC
CGCTGCGCGCCGCCCAGGTGATCGTCAGCGACGTGGAAGGTGAGCCGGGTTGGTACCGCGTCAGCTTGAA
CGTGCGTCCGCACTTCAAGTACATGGGTGCCGACTTCACCCTGTCGCTGGTCGGCAAGCTGGACAAGGAG
TAA