SecReT6
Protein ID: 104779790
SecReT6 ID125
T6SS typei1
Gene symbol-
Locus tagPSEEN0525
StrainPseudomonas entomophila L48
Repliconchromosome [GenBank: NC_008027] [Browse all T6SS(s) in this replicon]
Location [Strand]541145..541561 [+]
Producthypothetical protein
NoteTssE
UniProt IDQ1IFT1
KEGG IDpen:PSEEN0525
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.30E-20, Aligned region: 24..114
Protein Sequence: 138 a.a.     [Download]
>gi|104779790|ref|YP_606288.1| hypothetical protein PSEEN0525 [Pseudomonas entomophila L48]
MNGYGSLFERLSGESDQRANWRREDAAMASVAAHLAKMLSTRAGSVQTLADYGLPDLNDMRLSLHDALSQ
ARRAIEHFIEAYEPRLSDVRVISRPRDHDQLKLAFSIEGQLEVDGIKRSVSFAARLDGSGQVSVSQGD
 
Nucleotide Sequence: 417 bp     [Download]
>gi|104779316|ref|NC_008027.1|:541145-541561 Pseudomonas entomophila L48 chromosome, complete genome
ATGAATGGTTACGGAAGCCTGTTCGAACGCCTGAGCGGCGAGTCCGACCAGCGTGCCAACTGGCGGCGTG
AAGACGCCGCCATGGCTTCCGTGGCCGCTCATCTGGCGAAGATGCTCAGCACCCGGGCCGGCAGCGTGCA
GACGCTTGCCGACTACGGGTTGCCGGACCTCAACGACATGCGCCTTAGCCTTCACGATGCGCTCAGCCAG
GCCCGTCGGGCCATCGAGCATTTCATCGAGGCCTACGAGCCGCGCCTGTCCGATGTCCGGGTGATTTCCC
GACCGCGTGATCACGATCAGCTCAAGCTGGCTTTCAGTATCGAAGGCCAGCTTGAGGTGGACGGCATCAA
GCGCTCTGTCAGTTTTGCCGCGCGCCTGGATGGCAGCGGGCAAGTCAGTGTCAGTCAAGGAGACTAA