SecReT6
Protein ID: 104779791
SecReT6 ID125
T6SS typei1
Gene symbol-
Locus tagPSEEN0526
StrainPseudomonas entomophila L48
Repliconchromosome [GenBank: NC_008027] [Browse all T6SS(s) in this replicon]
Location [Strand]541647..543434 [+]
Producthypothetical protein
NoteTssF
UniProt IDQ1IFT0
KEGG IDpen:PSEEN0526
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 8.50E-186, Aligned region: 4..595
Protein Sequence: 595 a.a.     [Download]
>gi|104779791|ref|YP_606289.1| hypothetical protein PSEEN0526 [Pseudomonas entomophila L48]
MSFNYYYQSELTALRQLGRRFAERSPALAPFLGQAGRDPDVERLLEGFAFLTGRLRQKLDDELPELTHSL
MHLLWPNYMRPLPAFSILQFDPLRQAGPALRVERDTPVEGKPIDGVSCRFRTCYPTEVLPLRLSALNYSL
NGQGALLSLRLDMNCDGNLGDVKLSKLRLHLAGERYISQMLYLSLLRSLAGIELMPLDSHGKPMLNAKGE
PLLLRAPAAKVHPVGFAEEEALIPYPLNTFRGYRFLQEYFAFQDKFLFVDVTGLEVLQSLPEETLKQVHG
VELRFDIRRGEAQRLRPTLDNVKLYCTPIANLFKHDALPIRLDGKQDEYLLLPAELDLEHCGVFSVDSVT
GWSPGGLGYQNYVPFESFEHDASFDVPQNRPHYSIRQRSSLLHDGLDTYLSFGVHQAESHETLSIELTCT
NQNLPRRLKLGDICMLSEETPEFLTFRNITPVTASYAPPLNRDFLWKLISNMSLNYLSLADVDALKVILE
TYDLPRYYDQHAEKVSRRLLGGLKSIRHQHVDRLHRGLPLRGLRTELTIDPEGYIGEGDLFVFASVLNEF
FALYASLNSYHELRVKSTQGEVYQWTPRMGLQPLL
 
Nucleotide Sequence: 1788 bp     [Download]
>gi|104779316|ref|NC_008027.1|:541647-543434 Pseudomonas entomophila L48 chromosome, complete genome
ATGTCCTTCAATTACTACTACCAAAGCGAGCTGACGGCACTGCGCCAGCTGGGGCGGCGCTTTGCCGAAC
GCAGCCCGGCGCTGGCGCCGTTCCTCGGCCAGGCCGGGCGCGACCCGGACGTCGAGCGCCTGCTCGAGGG
CTTCGCCTTCCTCACCGGCCGCTTGCGGCAGAAGCTCGACGACGAGCTGCCTGAACTCACCCACTCGCTG
ATGCACCTGCTGTGGCCGAACTACATGCGCCCGCTGCCGGCGTTCAGCATCCTGCAGTTCGACCCCCTGC
GCCAGGCCGGCCCGGCCCTGCGGGTCGAGCGCGACACGCCGGTTGAAGGCAAGCCGATCGACGGTGTCAG
CTGCCGCTTTCGCACCTGCTACCCGACCGAGGTGCTGCCGCTGCGCCTGAGCGCGCTGAACTACTCGCTC
AATGGCCAGGGCGCGCTGCTGAGCCTGCGCCTGGACATGAACTGCGACGGCAACCTGGGCGATGTGAAGC
TCAGCAAGCTGCGCCTGCACCTGGCCGGCGAGCGCTACATCAGCCAGATGCTCTACCTGAGCCTGCTGCG
CAGCCTGGCCGGTATCGAGCTGATGCCGCTGGACAGCCACGGCAAGCCGATGCTCAACGCCAAGGGCGAG
CCGCTGCTGCTGCGCGCGCCGGCGGCCAAGGTGCACCCGGTGGGCTTCGCCGAGGAAGAGGCGCTGATCC
CTTACCCGCTGAACACCTTCCGTGGCTACCGTTTCCTGCAGGAGTACTTCGCCTTCCAGGACAAGTTCCT
GTTCGTCGACGTGACCGGCCTGGAGGTGCTGCAGAGCCTGCCGGAGGAAACCCTCAAGCAGGTGCATGGC
GTCGAGCTGCGCTTCGACATCCGCCGTGGCGAGGCCCAGCGCCTGCGCCCGACCCTGGACAACGTCAAGC
TGTACTGCACGCCCATCGCCAACCTGTTCAAGCACGATGCGCTGCCCATCCGCCTGGATGGCAAGCAGGA
CGAATACCTGCTGCTGCCGGCCGAGCTCGACCTGGAGCATTGCGGGGTGTTCTCGGTCGATAGCGTGACC
GGCTGGAGCCCGGGTGGCCTGGGCTACCAGAACTACGTGCCGTTCGAATCGTTCGAGCACGACGCCAGCT
TCGACGTGCCGCAGAACCGCCCGCACTACAGCATCCGCCAGCGCTCCTCGCTGCTGCACGACGGCCTGGA
CACCTACCTGAGCTTCGGCGTGCACCAGGCCGAGTCCCACGAGACGCTGTCGATCGAGCTGACCTGCACC
AACCAGAACCTGCCGCGCCGGCTCAAGCTGGGCGACATCTGCATGCTCAGCGAGGAGACCCCCGAGTTCC
TCACCTTCCGCAACATCACGCCGGTCACCGCCAGCTACGCGCCGCCGCTGAACCGCGACTTCCTGTGGAA
GCTGATCAGCAACATGTCGCTGAACTACCTGTCGCTGGCCGACGTCGACGCGCTCAAGGTGATCCTCGAG
ACCTACGACCTGCCGCGCTACTACGACCAGCACGCCGAGAAAGTCAGCCGGCGCCTGCTCGGCGGGCTCA
AGTCGATCCGCCACCAGCACGTCGACCGCCTGCACCGTGGCCTGCCGCTGCGCGGCCTGCGCACCGAGCT
GACCATCGACCCGGAAGGCTACATCGGCGAGGGCGACCTGTTCGTCTTCGCCTCGGTGCTCAATGAATTC
TTCGCGCTCTATGCCAGCCTCAACTCGTACCACGAGTTGCGGGTGAAAAGCACACAAGGGGAGGTGTACC
AATGGACACCACGCATGGGCCTGCAACCGCTGCTGTAA