SecReT6
Protein ID: 104779793
SecReT6 ID125
T6SS typei1
Gene symbol-
Locus tagPSEEN0528
StrainPseudomonas entomophila L48
Repliconchromosome [GenBank: NC_008027] [Browse all T6SS(s) in this replicon]
Location [Strand]544418..547036 [+]
ProductClpA/B-type protease
NoteTssH
UniProt IDQ1IFS8
KEGG IDpen:PSEEN0528
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 7.30E-44, Aligned region: 206..257
AAA_2 [PF07724], Evalue: 7.30E-44, Aligned region: 606..771
AAA [PF00004], Evalue: 1.40E-19, Aligned region: 208..339
AAA [PF00004], Evalue: 1.40E-19, Aligned region: 611..735
AAA_5 [PF07728], Evalue: 3.50E-13, Aligned region: 208..228
AAA_5 [PF07728], Evalue: 3.50E-13, Aligned region: 267..338
AAA_5 [PF07728], Evalue: 3.50E-13, Aligned region: 610..729
ClpB_D2-small [PF10431], Evalue: 8.60E-12, Aligned region: 443..468
ClpB_D2-small [PF10431], Evalue: 8.60E-12, Aligned region: 506..530
ClpB_D2-small [PF10431], Evalue: 8.60E-12, Aligned region: 741..760
ClpB_D2-small [PF10431], Evalue: 8.60E-12, Aligned region: 782..850
AAA_16 [PF13191], Evalue: 2.10E-10, Aligned region: 52..52
AAA_16 [PF13191], Evalue: 2.10E-10, Aligned region: 185..229
AAA_16 [PF13191], Evalue: 2.10E-10, Aligned region: 252..286
AAA_16 [PF13191], Evalue: 2.10E-10, Aligned region: 581..647
AAA_16 [PF13191], Evalue: 2.10E-10, Aligned region: 675..704
AAA_16 [PF13191], Evalue: 2.10E-10, Aligned region: 752..814
AAA_22 [PF13401], Evalue: 1.70E-09, Aligned region: 207..294
AAA_22 [PF13401], Evalue: 1.70E-09, Aligned region: 468..537
AAA_22 [PF13401], Evalue: 1.70E-09, Aligned region: 609..724
AAA_17 [PF13207], Evalue: 3.50E-06, Aligned region: 208..261
AAA_17 [PF13207], Evalue: 3.50E-06, Aligned region: 443..482
AAA_17 [PF13207], Evalue: 3.50E-06, Aligned region: 609..645
AAA_19 [PF13245], Evalue: 1.80E-05, Aligned region: 205..230
AAA_19 [PF13245], Evalue: 1.80E-05, Aligned region: 349..384
AAA_19 [PF13245], Evalue: 1.80E-05, Aligned region: 608..632
Clp_N [PF02861], Evalue: 4.50E-05, Aligned region: 26..71
Clp_N [PF02861], Evalue: 4.50E-05, Aligned region: 102..122
Sigma54_activat [PF00158], Evalue: 4.90E-05, Aligned region: 203..224
Sigma54_activat [PF00158], Evalue: 4.90E-05, Aligned region: 609..728
IstB_IS21 [PF01695], Evalue: 0.00015, Aligned region: 201..229
IstB_IS21 [PF01695], Evalue: 0.00015, Aligned region: 610..628
IstB_IS21 [PF01695], Evalue: 0.00015, Aligned region: 800..836
AAA_29 [PF13555], Evalue: 0.00054, Aligned region: 202..226
AAA_29 [PF13555], Evalue: 0.00054, Aligned region: 608..635
NACHT [PF05729], Evalue: 0.00055, Aligned region: 208..234
NACHT [PF05729], Evalue: 0.00055, Aligned region: 610..635
NACHT [PF05729], Evalue: 0.00055, Aligned region: 816..839
AAA_18 [PF13238], Evalue: 0.001, Aligned region: 208..228
AAA_18 [PF13238], Evalue: 0.001, Aligned region: 461..527
AAA_18 [PF13238], Evalue: 0.001, Aligned region: 611..642
DUF258 [PF03193], Evalue: 0.0019, Aligned region: 174..226
DUF258 [PF03193], Evalue: 0.0019, Aligned region: 609..623
SRP54 [PF00448], Evalue: 0.0021, Aligned region: 208..241
SRP54 [PF00448], Evalue: 0.0021, Aligned region: 609..631
Zeta_toxin [PF06414], Evalue: 0.0049, Aligned region: 207..227
Zeta_toxin [PF06414], Evalue: 0.0049, Aligned region: 448..489
Zeta_toxin [PF06414], Evalue: 0.0049, Aligned region: 609..650
AAA_25 [PF13481], Evalue: 0.0063, Aligned region: 208..232
AAA_25 [PF13481], Evalue: 0.0063, Aligned region: 264..304
AAA_25 [PF13481], Evalue: 0.0063, Aligned region: 412..460
AAA_25 [PF13481], Evalue: 0.0063, Aligned region: 510..540
AAA_25 [PF13481], Evalue: 0.0063, Aligned region: 607..639
MobB [PF03205], Evalue: 0.0063, Aligned region: 208..236
MobB [PF03205], Evalue: 0.0063, Aligned region: 609..632
Protein Sequence: 872 a.a.     [Download]
>gi|104779793|ref|YP_606291.1| ClpA/B-type protease [Pseudomonas entomophila L48]
MINVDLQQLVQALDADSRRDLERSAERCVARGGSKILVEDLLLGLLERSDSLLQRALQDAAVDVGEFSAA
LQPNVEHSATRNPVFAPELVQWLQDALLVSNLELGQSQVDQAALILGLLRNPLRYAGSRYHKLLSGLDIE
RLKGYALSQQPAAPKAAGAPQGESMLQRFTHNLTQQARDGKLDPVLCRDASIRQMIDILARRRKNNPIVV
GEAGVGKTAVVEGLAARIVAGEVPPALQGVDLLALDMGLLQAGASVKGEFERRLKGVIDEVKAAPRPVIL
FIDEAHTLIGAGGNAGGSDAANLLKPALARGELRTIAATTWAEYKKYFEKDPALARRFQPVQLHEPTVGE
AVTILRGLAQLYEKSHGIYLRDDAVVAAAELSARYLTGRQLPDKAVDVLDTACARVRISLAAAPDSLERL
RAELAEGERQRNALRRDAEAGLEIDQEAFERLEQRLAEAHDQEIELDARWARQRELAEQVLELRQQVANA
PVEAPAPTEGEEGEDAIVGESREQLQQRLAETHQALLDAQAEERLVSAEVCPRLVAEVISAWTGVPLSQL
AREHNAKVISFADDLRARIRGQEQAVHALNRAMRATAAGLNKPDAPVGVFLLVGPSGVGKTETALALADL
LYGGDRFITTINMSEFQEKHTVSRLIGAPPGYVGYGEGGMLTEAVRQKPYSVVLLDEVEKADPDVLNLFY
QIFDKGVANDGEGRQIDFRNTLILMTSNLASDQISALCENGERPDAELLEQHIRPVLSRHFKPALLARMR
VVPYYPVGGPVLRELIEIKLGRLGERLQRRQLAFSHCQALVDHLAERCSQSESGARLIDHLIDTHVLPKV
ADRLLDAMASGEAISRVHATLDADAGVICEFA
 
Nucleotide Sequence: 2619 bp     [Download]
>gi|104779316|ref|NC_008027.1|:544418-547036 Pseudomonas entomophila L48 chromosome, complete genome
ATGATCAACGTAGACCTGCAACAACTCGTCCAGGCCCTGGACGCCGACAGCCGCCGCGACCTGGAGCGCT
CCGCCGAGCGCTGCGTGGCCCGTGGCGGCAGCAAGATCCTGGTGGAGGACCTGCTGCTGGGGCTGCTCGA
ACGCAGCGACAGCCTGCTGCAGCGTGCCCTGCAGGACGCGGCAGTCGACGTCGGCGAGTTCAGCGCCGCA
CTGCAGCCGAATGTCGAGCACAGCGCCACCCGCAACCCGGTGTTCGCGCCGGAGCTGGTGCAGTGGCTGC
AGGATGCGTTGTTGGTTTCCAACCTCGAGCTGGGCCAGAGCCAGGTCGACCAGGCCGCGTTGATCCTTGG
TCTGCTGCGCAACCCGCTGCGCTATGCCGGCAGCCGCTACCACAAGCTGCTGTCGGGCCTGGATATCGAG
CGTCTCAAGGGCTATGCCCTGTCGCAACAGCCTGCCGCACCGAAGGCTGCTGGCGCGCCCCAGGGCGAGT
CGATGCTGCAGCGCTTCACCCACAACCTCACCCAGCAGGCCCGTGACGGCAAGCTCGACCCGGTGCTGTG
CCGCGATGCGTCGATCCGCCAGATGATCGATATCCTCGCCCGCCGCCGCAAGAACAACCCGATCGTGGTC
GGCGAGGCCGGCGTGGGCAAGACCGCCGTGGTCGAGGGCCTGGCCGCGCGGATCGTCGCTGGTGAAGTGC
CGCCGGCGCTGCAAGGTGTCGACCTGCTGGCGCTGGACATGGGCCTGCTGCAGGCCGGGGCCAGCGTCAA
GGGCGAGTTCGAGCGCCGCCTGAAAGGCGTGATCGATGAGGTCAAGGCCGCGCCGCGCCCGGTGATCCTG
TTCATCGACGAAGCCCATACGCTGATCGGCGCGGGCGGCAATGCCGGTGGTTCCGACGCCGCCAACCTGC
TCAAGCCGGCGCTGGCGCGTGGCGAGTTGCGCACCATCGCCGCCACCACCTGGGCCGAGTACAAGAAGTA
CTTCGAGAAGGATCCGGCCCTGGCCCGTCGCTTCCAGCCGGTGCAACTGCACGAGCCGACCGTGGGCGAG
GCGGTGACCATCCTGCGCGGCCTGGCCCAGCTGTACGAGAAGAGCCACGGCATCTACCTGCGTGATGACG
CCGTGGTCGCCGCGGCCGAGCTGTCGGCGCGCTACCTGACCGGCCGCCAGTTGCCCGACAAGGCCGTCGA
CGTGCTCGACACTGCCTGTGCCCGTGTACGCATCAGCCTGGCCGCGGCACCGGACAGCCTTGAGCGCCTG
CGTGCCGAACTGGCCGAGGGCGAGCGCCAGCGCAACGCCTTGCGCCGCGATGCCGAGGCGGGGCTTGAGA
TCGACCAAGAGGCCTTCGAGCGCCTGGAGCAGCGCCTGGCCGAAGCCCATGACCAGGAAATCGAGCTGGA
CGCCCGCTGGGCCCGTCAGCGTGAGCTGGCCGAGCAGGTGCTGGAGCTGCGCCAGCAGGTCGCCAACGCC
CCCGTCGAAGCGCCAGCGCCAACTGAAGGCGAGGAGGGCGAGGACGCCATTGTCGGCGAAAGCCGCGAAC
AGCTCCAGCAGCGCCTGGCCGAGACCCACCAGGCCCTGCTCGACGCCCAGGCCGAGGAACGCCTGGTCAG
CGCCGAAGTGTGCCCGCGCCTGGTGGCCGAAGTGATCAGCGCCTGGACCGGCGTGCCCCTGAGCCAGCTG
GCCCGCGAGCACAACGCCAAGGTGATCAGCTTCGCCGACGACCTGCGCGCGCGCATCCGTGGCCAGGAGC
AGGCCGTGCACGCGCTCAACCGCGCCATGCGCGCCACCGCCGCCGGCCTGAACAAGCCCGATGCGCCGGT
GGGTGTGTTCCTGCTGGTCGGCCCCAGCGGCGTCGGCAAGACCGAGACCGCGCTGGCGCTGGCCGACCTG
CTGTACGGCGGCGACCGCTTCATCACCACCATCAACATGTCCGAGTTCCAGGAGAAGCACACCGTCTCGC
GCCTGATCGGCGCGCCGCCCGGCTACGTCGGTTACGGCGAGGGCGGCATGCTCACCGAGGCGGTGCGCCA
GAAGCCGTATTCGGTGGTGCTGCTGGACGAGGTGGAGAAGGCCGACCCGGACGTGCTCAACCTGTTCTAC
CAGATCTTCGACAAGGGCGTGGCCAACGACGGTGAAGGGCGCCAGATCGATTTCCGCAACACGCTGATCC
TGATGACCTCGAACCTGGCCAGCGACCAGATCAGCGCCCTGTGCGAAAACGGTGAGCGCCCGGACGCCGA
GCTGCTCGAACAGCATATCCGCCCGGTGCTCAGCCGCCACTTCAAGCCGGCCCTGCTGGCGCGCATGCGC
GTGGTGCCGTACTACCCGGTGGGCGGCCCGGTGCTGCGCGAGCTGATCGAGATCAAGCTGGGCCGCCTGG
GCGAGCGCCTGCAGCGCAGGCAACTGGCGTTCAGCCACTGCCAGGCGCTGGTCGACCACCTGGCCGAGCG
TTGCAGCCAGAGCGAAAGCGGCGCGCGCCTGATCGACCACCTGATCGACACCCACGTGCTGCCCAAGGTG
GCCGACCGCCTGCTCGACGCCATGGCCAGCGGCGAGGCGATCAGCCGCGTGCACGCCACCCTCGACGCGG
ATGCCGGCGTGATCTGCGAGTTTGCCTGA