SecReT6
Protein ID: 104779796
SecReT6 ID125
T6SS typei1
Gene symbol-
Locus tagPSEEN0531
StrainPseudomonas entomophila L48
Repliconchromosome [GenBank: NC_008027] [Browse all T6SS(s) in this replicon]
Location [Strand]548810..549991 [+]
Producthypothetical protein
NoteFha
UniProt IDQ1IFS5
KEGG IDpen:PSEEN0531
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 3.60E-12, Aligned region: 30..97
Protein Sequence: 393 a.a.     [Download]
>gi|104779796|ref|YP_606294.1| hypothetical protein PSEEN0531 [Pseudomonas entomophila L48]
MELVFELLDKRQHGRTDSPTKTFGRAGGEIGRAKDCHWSIEDDKRHLSSHHAQVTYENGGFYLTDISSNG
VRLASSGAQLRKGEPYRIEQGAVYRLGDIEVRARLIDSEPGMDVSLGMPGGNIIPDDAFLELDPISALDQ
EESRLHPMDELAAMAMPEPPARQRADYAQIDRESLIVPTLVPAVAPEPAPAPAPRERRDDAFWKRFGAAL
GVDMDNLDEQAREDLAVQAAGLLRHSIGGLQQSLRTRSELKNELRLSLTTPQGASRNPIKAPLEADQVLG
ELLKPRRGGQMSAEQAVSQAFRDLQAHQVAMLGASRHALRSTLEHFAPEQLVLQFERQGRRGLFGSRWKS
YVRYHQALMGNEDWSERLLAKDFARTYEEQVRLIASLHHDPQG
 
Nucleotide Sequence: 1182 bp     [Download]
>gi|104779316|ref|NC_008027.1|:548810-549991 Pseudomonas entomophila L48 chromosome, complete genome
ATGGAACTGGTTTTCGAACTGCTCGACAAACGCCAGCACGGCCGCACCGACTCGCCGACCAAGACCTTCG
GCCGCGCCGGTGGCGAGATCGGCCGGGCCAAGGATTGCCACTGGAGCATCGAGGATGACAAGCGTCACCT
GTCCAGCCATCACGCCCAGGTCACCTACGAGAACGGCGGGTTCTACCTGACCGACATCAGCAGCAACGGC
GTGCGCCTGGCCAGCAGCGGTGCCCAGCTGCGCAAGGGCGAGCCGTACCGCATCGAGCAGGGCGCGGTGT
ACCGCCTGGGCGACATCGAAGTGCGCGCGCGGCTGATCGACAGCGAGCCGGGCATGGATGTCAGCCTGGG
CATGCCGGGCGGCAACATCATCCCCGACGACGCCTTCCTCGAACTCGACCCGATCAGCGCCCTGGACCAG
GAAGAGTCCCGCCTGCATCCGATGGACGAGCTGGCGGCCATGGCCATGCCCGAGCCACCGGCCCGCCAGC
GCGCCGACTACGCGCAGATCGACCGCGAAAGCCTGATCGTGCCGACCCTGGTGCCAGCCGTAGCACCGGA
GCCCGCGCCTGCGCCGGCCCCGCGCGAGCGTCGCGACGACGCCTTCTGGAAGCGCTTCGGTGCCGCCCTC
GGGGTGGACATGGACAACCTCGACGAGCAGGCCCGCGAAGACCTGGCGGTGCAGGCCGCCGGGCTGCTGC
GCCACAGCATCGGCGGTTTGCAGCAGAGCCTGCGTACCCGCAGCGAGCTGAAGAACGAACTGCGCCTGTC
GCTGACCACTCCGCAAGGTGCCAGCCGCAACCCGATCAAGGCGCCGCTGGAGGCCGACCAGGTACTCGGC
GAGCTGCTCAAGCCACGCCGTGGCGGGCAGATGTCCGCCGAGCAGGCGGTGTCCCAGGCCTTCCGCGACC
TGCAGGCGCACCAGGTGGCCATGCTCGGCGCCAGCCGCCACGCGCTGCGCAGCACCCTGGAGCACTTCGC
CCCGGAACAGCTGGTATTGCAGTTCGAGCGCCAGGGCCGCCGGGGCCTGTTCGGTAGCCGCTGGAAATCC
TACGTGCGCTACCACCAGGCCCTGATGGGCAACGAAGACTGGAGCGAGCGACTGCTGGCCAAGGACTTCG
CCCGAACCTACGAAGAGCAGGTGCGCCTGATCGCTTCCCTTCATCACGACCCGCAAGGATGA