SecReT6
Protein ID: 104779797
SecReT6 ID125
T6SS typei1
Gene symbol-
Locus tagPSEEN0532
StrainPseudomonas entomophila L48
Repliconchromosome [GenBank: NC_008027] [Browse all T6SS(s) in this replicon]
Location [Strand]549997..550503 [+]
Producthypothetical protein
NoteTssJ
UniProt IDQ1IFS4
KEGG IDpen:PSEEN0532
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.90E-40, Aligned region: 20..153
Protein Sequence: 168 a.a.     [Download]
>gi|104779797|ref|YP_606295.1| hypothetical protein PSEEN0532 [Pseudomonas entomophila L48]
MTRITRTMLRATWALATLSWLAGCSALSPYSHMTKLDLTLTATDQLNLDINGRPSPVVVRLFELKHPVAF
ETTDFFSLYQRPKEALSPDMVASEEHELRPGETLTLKLSIDPDSRFVGIMAAYRDLDQAQWRRVQAIRAG
ERVTANFYLDQAGIHNGVPAVAQAGERP
 
Nucleotide Sequence: 507 bp     [Download]
>gi|104779316|ref|NC_008027.1|:549997-550503 Pseudomonas entomophila L48 chromosome, complete genome
ATGACTCGCATCACCCGCACGATGCTCAGGGCGACGTGGGCCCTGGCCACCTTGTCCTGGCTGGCCGGCT
GCAGCGCCCTGTCGCCGTATTCGCACATGACCAAGCTCGACCTCACGCTGACCGCCACCGACCAGCTCAA
CCTGGACATCAATGGCCGGCCGTCGCCGGTGGTGGTGCGCCTGTTCGAGCTCAAGCACCCGGTGGCGTTC
GAGACCACCGATTTCTTCAGCCTCTACCAGCGCCCGAAAGAAGCCCTGTCGCCGGACATGGTGGCCAGCG
AGGAGCATGAGCTGCGTCCGGGCGAGACCCTGACCCTCAAGCTCAGCATCGACCCCGACAGCCGCTTCGT
CGGCATCATGGCCGCCTACCGCGACCTCGACCAGGCGCAGTGGCGCCGGGTGCAGGCGATCCGCGCCGGC
GAGCGCGTGACCGCCAACTTCTACCTGGACCAGGCCGGTATCCACAATGGCGTGCCGGCAGTGGCACAAG
CGGGTGAGCGCCCATGA